- Search results for Q9P0L9
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "Q9P0L9"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA070002.100
Polyclonal Antibody against Human PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Validated applications: ICC, Uniprot ID: Q9P0L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
Keywords: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*
Item number: CSB-PA214505.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Keywords: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA960366.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Keywords: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: DIM-FLP100773.10
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Keywords: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Application: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
Expressed in: | Human cells |
Origin: | human |
MW: | 92 kD |
From 1,291.00€
*

Item number: DIM-FLP120773.10
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Keywords: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Application: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
Expressed in: | Human cells |
Origin: | human |
MW: | 92 kD |
From 1,162.00€
*

Item number: ABS-PP-5501.100
Keywords: | Polycystin-2-like protein 1, Polycystin-2L1, Polycystic kidney disease 2-like 1 protein, Polycystin-2 homolog,... |
MW: | 29.5 kD |
From 90.00€
*

Item number: ATA-APrEST96085.100
PrEST Antigen PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Antigen sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-PA865199DSR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Keywords: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA018062GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Keywords: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
552.00€
*

Item number: CSB-CL865199HU.10
Length: 2418 Sequence: atgaatgctg tgggaagtcc tgaggggcag gagctgcaaa agctggggag tggagcctgg gacaaccccg cctacagtgg tcccccttcc ccacacggga cgctgagagt ctgcaccatc tccagcacgg ggcctctcca gccccaaccc aagaagcctg aagatgaacc ccaggagacg gcatacagga cccaggtgtc cagctgctgc ctccatatct gtcaaggcat cagaggactt tggggaacaa ccctgactga...
Keywords: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Application: | Molecular biology, clone |
Species reactivity: | human |
879.00€
*

Item number: VHPS-6930
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | PKD2L, PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Application: | RNA quantification |
44.00€
*

Item number: 040096.200
PKD2L1 is a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel....
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
767.00€
*