16 products were found matching "Q96JL9"!
No results were found for the filter!
Anti-ZNF333
Item number: ATA-HPA077662.100
Polyclonal Antibody against Human ZNF333, Gene description: zinc finger protein 333, Alternative Gene Names: KIAA1806, Validated applications: ICC, Uniprot ID: Q96JL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-ZNF333
Item number: ARG40063.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
658.00€
*
Anti-ZNF333
Item number: ATA-HPA043973.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 31% and to rat: 31%
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 358.00€
*
Anti-ZNF333
Item number: ATA-HPA054680.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 28% and to rat: 25%
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 239.00€
*
ZNF333 (human), recombinant protein
Item number: ABS-PP-2631.100
| Keywords: | Zinc finger protein 333, Recombinant Human ZNF333 Protein |
| MW: | 15.5 kD |
From 90.00€
*
ZNF333 PrEST Antigen
Item number: ATA-APrEST95831.100
PrEST Antigen ZNF333, Gene description: zinc finger protein 333, Alternative Gene Names: KIAA1806, Antigen sequence: QCQPQEAIPSQDTFTEILSIDVKGEQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASCECQEIRNSFFQSAHLIVPEKIRSGDKSYACNKCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
| Keywords: | ZNF333, KIAA1806, Zinc finger protein 333 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-ZNF333, Biotin conjugated
Item number: CSB-PA026681LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF333
Item number: CSB-PA026681LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF333, HRP conjugated
Item number: CSB-PA026681LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF333, FITC conjugated
Item number: CSB-PA026681LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
| Keywords: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
ZNF333 (Vector Vector will be determined during the...
Item number: CSB-CL026681HU1.10
Length: 549 Sequence: atggaatccg tcacctttga ggatgtggcc gtggagttca tccaggagtg ggcattgctg gacagcgcac ggaggagcct gtgcaaatac aggatgcttg accagtgcag gaccctggcc tccaggggaa ctccaccatg caaacccagt tgtgtctccc agctggggca aagagcagag ccaaaggcaa cagaacgagg gattctccgt gccacaggtg ttgcctggga atctcaactt aaacccgaag agttgccttc...
| Keywords: | ZNF333, KIAA1806, Zinc finger protein 333 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
ZNF333 (Vector pUC, Accession No. BC048107)
Item number: CSB-CL026681HU2.10
Length: 912 Sequence: atggaatccg tcacctttga ggatgtggcc gtggagttca tccaggagtg ggcattgctg gacagcgcac ggaggagcct gtgcaaatac aggatgcttg accagtgcag gaccctggcc tccaggggaa ctccaccatg caaacccagt tgtgtctccc agctggggca aagagcagag ccaaaggcaa cagaacgagg gattctccgt gccacaggtg ttgcctggga atctcaactt aaacccgaag agttgccttc...
| Keywords: | ZNF333, KIAA1806, Zinc finger protein 333 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
343.00€
*