12 products were found matching "Q8R459"!
No results were found for the filter!
IL-1F10 Protein, Mouse, Recombinant (His & SUMO)
Item number: TGM-TMPH-02737-100ug
Description: IL-1F10 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli.
| Keywords: | Interleukin-1 family member 10, Il1f10 |
| MW: | 33.1 kD |
From 359.00€
*
Interleukin-1 family member 10 (Il1f10), mouse, recombinant
Item number: CSB-YP837144MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ PVQLTKESEP...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | mouse |
| MW: | 19.1 kD |
From 407.00€
*
Interleukin-1 family member 10 (Il1f10), mouse, recombinant
Item number: CSB-EP837144MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 33.1 kD |
From 364.00€
*
Mouse IL1F10 ELISA Kit
Item number: ARG82064.96
Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Application: | ELISA |
| Species reactivity: | mouse |
1,118.00€
*
IL-38 (aa 3-152) (mouse) (monomeric):Fc-KIH (human) (rec.)
Item number: AG-40B-0227-3010
IL-38 (IL-1F10) belongs to the IL-1 family of proteins. IL-38 is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-38 in the inflammatory response. It has been reported that removal of the N-terminus...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Application: | Bioassays |
| Expressed in: | Human cells |
| Origin: | mouse |
| MW: | ~52+28 kD |
From 429.00€
*
IL-38, Mouse
Item number: CR-C02041-100UG
Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY EQTTRFTFFQ RSLGSAFRLE AAACPGWFLC GPAEPQQPVQ LTKESEPSTH with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine with...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Expressed in: | E.coli |
| Origin: | mouse |
From 110.00€
*
NEW
Anti-Il1f10
Item number: CSB-PA837144ZA01MO.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-Il1f10, Anti-IL-1F10, Anti-Interleukin-1 family member 10, Il1f10 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Mus musculus (Mouse) |
From 1,529.00€
*
Interleukin-38 (IL-38), (mouse, rec.), (FLAG)
Item number: AG-40B-0101-C010
IL-38 [IL-1F10] (mouse) (aa 3-152) is fused at the C-terminus o a FLAG®-tag. IL-38 (IL-1F10) mRNA is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-1F10 in the inflammatory response.
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Application: | Bioassays |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 20 kD |
From 352.00€
*
Mouse IL-38 Recombinant Protein (N-His)
Item number: G-RPES6706.20
Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T- cells in response to heat-killed Candida albicans. Reduces IL36G- induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Expressed in: | E.coli |
| Origin: | mouse |
299.00€
*
Il1f10, Recombinant, Mouse, aa1-152, His-SUMO-Tag...
Item number: 373808.20
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| MW: | 33,1 |
From 549.00€
*
Il1f10, Recombinant, Mouse, aa1-152, His-Tag...
Item number: 373809.100
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| MW: | 19,1 |
From 620.00€
*
IL-38 protein(N-His) (recombinant mouse)
Item number: E-PKSM041483.100
Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with immunomodulatory...
| Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse IL-38 protein(N-His) |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 17.9 kD |
From 289.00€
*