12 products were found matching "Q8R459"!

No results were found for the filter!
IL-1F10 Protein, Mouse, Recombinant (His & SUMO)
IL-1F10 Protein, Mouse, Recombinant (His & SUMO)

Item number: TGM-TMPH-02737-100ug

Description: IL-1F10 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli.
Keywords: Interleukin-1 family member 10, Il1f10
MW: 33.1 kD
From 359.00€ *
Review
Interleukin-1 family member 10 (Il1f10), mouse, recombinant
Interleukin-1 family member 10 (Il1f10), mouse, recombinant

Item number: CSB-YP837144MO.1

Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ PVQLTKESEP...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10)
Application: Activity not tested
Expressed in: Yeast
Origin: mouse
MW: 19.1 kD
From 407.00€ *
Review
Interleukin-1 family member 10 (Il1f10), mouse, recombinant
Interleukin-1 family member 10 (Il1f10), mouse, recombinant

Item number: CSB-EP837144MO.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10)
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 33.1 kD
From 364.00€ *
Review
Mouse IL1F10 ELISA Kit
Mouse IL1F10 ELISA Kit

Item number: ARG82064.96

Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10
Application: ELISA
Species reactivity: mouse
1,118.00€ *
Review
IL-38 (aa 3-152) (mouse) (monomeric):Fc-KIH (human) (rec.)
IL-38 (aa 3-152) (mouse) (monomeric):Fc-KIH (human) (rec.)

Item number: AG-40B-0227-3010

IL-38 (IL-1F10) belongs to the IL-1 family of proteins. IL-38 is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-38 in the inflammatory response. It has been reported that removal of the N-terminus...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10
Application: Bioassays
Expressed in: Human cells
Origin: mouse
MW: ~52+28 kD
From 429.00€ *
Review
IL-38, Mouse
IL-38, Mouse

Item number: CR-C02041-100UG

Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY EQTTRFTFFQ RSLGSAFRLE AAACPGWFLC GPAEPQQPVQ LTKESEPSTH with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine with...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10
Expressed in: E.coli
Origin: mouse
From 110.00€ *
Review
NEW
Anti-Il1f10
Anti-Il1f10

Item number: CSB-PA837144ZA01MO.2

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-Il1f10, Anti-IL-1F10, Anti-Interleukin-1 family member 10, Il1f10 Antibody
Application: ELISA, WB
Host: Rabbit
Species reactivity: Mus musculus (Mouse)
From 1,529.00€ *
Review
Interleukin-38 (IL-38), (mouse, rec.),  (FLAG)
Interleukin-38 (IL-38), (mouse, rec.), (FLAG)

Item number: AG-40B-0101-C010

IL-38 [IL-1F10] (mouse) (aa 3-152) is fused at the C-terminus o a FLAG®-tag. IL-38 (IL-1F10) mRNA is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-1F10 in the inflammatory response.
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10
Application: Bioassays
Expressed in: E.coli
Origin: mouse
MW: 20 kD
From 352.00€ *
Review
Mouse IL-38 Recombinant Protein (N-His)
Mouse IL-38 Recombinant Protein (N-His)

Item number: G-RPES6706.20

Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T- cells in response to heat-killed Candida albicans. Reduces IL36G- induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10
Expressed in: E.coli
Origin: mouse
299.00€ *
Review
Il1f10, Recombinant, Mouse, aa1-152, His-SUMO-Tag (Interleukin-1 Family Member 10)
Il1f10, Recombinant, Mouse, aa1-152, His-SUMO-Tag...

Item number: 373808.20

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10
MW: 33,1
From 549.00€ *
Review
Il1f10, Recombinant, Mouse, aa1-152, His-Tag (Interleukin-1 Family Member 10)
Il1f10, Recombinant, Mouse, aa1-152, His-Tag...

Item number: 373809.100

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10
MW: 19,1
From 620.00€ *
Review
IL-38 protein(N-His) (recombinant mouse)
IL-38 protein(N-His) (recombinant mouse)

Item number: E-PKSM041483.100

Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with immunomodulatory...
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse IL-38 protein(N-His)
Expressed in: E.coli
Origin: mouse
MW: 17.9 kD
From 289.00€ *
Review