18 products were found matching "Q04745"!

1 from 2 pages
No results were found for the filter!
IL-4, Swine
IL-4, Swine

Item number: CR-C03004-100UG

Sequence: MHKCDITLQE IIKTLNILTA RKNSCMELPV TDVFAAPENT TEKETFCRAS TVLRHIYRHH TCMKSLLSGL DRNLSSMANM TCSVHEAKKS FLERLKTIMK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Participates in at least several B-cell activation processes as well...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Application: Cell culture
Expressed in: E.coli
Origin: swine
From 120.00€ *
Review
Pig IL4 (Interleukin 4) ELISA Kit
Pig IL4 (Interleukin 4) ELISA Kit

Item number: ELK-ELK5717.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL4. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL4. Next, Avidin...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Application: ELISA
Species reactivity: swine
From 470.00€ *
Review
Porcine IL4 ELISA Kit
Porcine IL4 ELISA Kit

Item number: ARG81290.96

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Application: ELISA
Species reactivity: swine
824.00€ *
Review
IL-4 (pig) ELISA kit
IL-4 (pig) ELISA kit

Item number: BR-A05420.96

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
553.00€ *
Review
Porcine IL4 ELISA Kit
Porcine IL4 ELISA Kit

Item number: G-PRFI00098.96

Application: ELISA
Species reactivity: swine
641.00€ *
Review
Interleukin-4 (IL-4) (swine) Do-It-Yourself ELISA
Interleukin-4 (IL-4) (swine) Do-It-Yourself ELISA

Item number: DIY0726S-003

The swine IL-4 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-4 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
Keywords: IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1
Application: ELISA
Species reactivity: swine
From 1,056.00€ *
Review
Anti-Interleukin-4 (IL-4) (swine)
Anti-Interleukin-4 (IL-4) (swine)

Item number: PB0475S-100

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1
Application: ELISA
Host: Goat
Species reactivity: swine, bovine, dolphin, feline
521.00€ *
Review
Pig IL4 recombinant protein (Active)
Pig IL4 recombinant protein (Active)

Item number: ARG70204.100

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Application: SDS-PAGE, Cell culture
Origin: swine
From 336.00€ *
Review
Pig interleukin 4, IL-4 ELISA Kit
Pig interleukin 4, IL-4 ELISA Kit

Item number: CSB-E06785p.48

Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Participates in at least several B-cell...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Application: ELISA, Sandwich ELISA
Species reactivity: swine
From 435.00€ *
Review
Swine IL-4 Recombinant Protein (N-His) (active)
Swine IL-4 Recombinant Protein (N-His) (active)

Item number: G-RPES6847.5

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Expressed in: E.coli
331.00€ *
Review
Porcine IL-4(Interleukin 4) ELISA Kit
Porcine IL-4(Interleukin 4) ELISA Kit

Item number: E-EL-P3006.24

Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.89 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Application: ELISA
Species reactivity: swine
From 119.00€ *
Review
IL-4 protein(N-His)(active) (recombinant swine)
IL-4 protein(N-His)(active) (recombinant swine)

Item number: E-PKSS000004.5

Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more...
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Recombinant Swine IL-4...
Application: Active, cell culture
Expressed in: E.coli
Origin: swine
MW: 15.85 kD
234.00€ *
Review
1 from 2 pages