9 products were found matching "P55201"!

No results were found for the filter!
BRPF1 (627-746), human recombinant protein, N-terminal His tag
BRPF1 (627-746), human recombinant protein, N-terminal...

Item number: BPS-31112

Human Bromodomain and PHD finger containing 1, or BRPF1, amino-acids 627 ? 746 (GenBank Accession No. NM_001003694) with N-terminal HIS-tag, MW = 15.1 kDa, expressed in an E. coli expression system.
Keywords: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1,
Application: BRD binding assays, inhibitor screening, selectivity profiling
Expressed in: E.coli
Origin: human
MW: 14.3 kD
461.00€ *
Review
Anti-BRPF1
Anti-BRPF1

Item number: ATA-HPA003359.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Keywords: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1
Application: IHC
Host: Rabbit
Species reactivity: human
From 239.00€ *
Review
BRPF1 (human), recombinant protein
BRPF1 (human), recombinant protein

Item number: ABS-PP-5851.100

Keywords: Peregrin, Bromodomain and PHD finger-containing protein 1, Protein Br140, Recombinant Human BRPF1 Protein
MW: 20.5 kD
From 90.00€ *
Review
Anti-Bromodomain and PHD Finger Containing 1 (BRPF1, BR1
Anti-Bromodomain and PHD Finger Containing 1 (BRPF1, BR1

Item number: B2852-48.50

The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two...
Keywords: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1
Application: ELISA, FC, IP, WB
Host: Mouse
Species reactivity: human, mouse
543.00€ *
Review
BRPF1, Recombinant, Human, aa2054-2168, His-Tag (Bromodomain and PHD Finger Containing 1)
BRPF1, Recombinant, Human, aa2054-2168, His-Tag...

Item number: 298382.100

Source:, Recombinant protein corresponding to aa2054-2168 from human Bromodomain and PHD finger containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.1kD, AA Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPL, SEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDF,...
Keywords: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1
MW: 15,1
937.00€ *
Review
BRPF1 PrEST Antigen
BRPF1 PrEST Antigen

Item number: ATA-APrEST84803.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Keywords: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1
Application: Control antigen
Expressed in: E.coli
Origin: human
265.00€ *
Review
Anti-BRPF1
Anti-BRPF1

Item number: G-CAB17012.20

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Keywords: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1
Application: WB, IF
Host: Rabbit
Species reactivity: human, mouse, rat
149.00€ *
Review
Anti-BRPF1
Anti-BRPF1

Item number: ELK-ES18906.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Keywords: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1, BRPF1 rabbit pAb
Application: WB
Host: Rabbit
Species reactivity: human, rat, mouse,
From 173.00€ *
Review
Anti-BRPF1
Anti-BRPF1

Item number: E-AB-91679.120

This gene encodes a bromodomain, PHD finger and chromo/Tudor-related Pro-Trp-Trp-Pro (PWWP) domain containing protein. The encoded protein is a component of the MOZ/MORF histone acetyltransferase complexes which function as a transcriptional regulators. This protein binds to the catalytic MYST domains of the MOZ and...
Keywords: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1, BRPF1 Polyclonal Antibody
Application: WB, IF
Host: Rabbit
Species reactivity: human, mouse, rat
From 243.00€ *
Review