21 products were found matching "P23409"!
No results were found for the filter!
Anti-MYF6
Item number: ATA-HPA065102.100
Polyclonal Antibody against Human MYF6, Gene description: myogenic factor 6, Alternative Gene Names: bHLHc4, MRF4, Validated applications: ICC, Uniprot ID: P23409, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in muscle differentiation (myogenic...
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-MYF6
Item number: CSB-PA003341.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 126.00€
*
Anti-MYF6
Item number: CSB-PA616344.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
283.00€
*
Anti-MYF6
Item number: ARG10823.50
Protein function: Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein. [The UniProt Consortium]
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | IHC (paraffin), WB |
| Host: | Rabbit |
| Species reactivity: | human |
592.00€
*
Anti-MYF6
Item number: NSJ-R36119-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Myogenic factor-6, MRF4, herculin Protein function: Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific...
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-bHLHc4, Anti-BHLHC4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | WB (transfected), ELISA (peptide) |
| Host: | Goat |
| Species reactivity: | human |
790.00€
*
MYF6 (human), recombinant protein
Item number: ABS-PP-4262.100
| Keywords: | Myogenic factor 6, Myf-6, Class C basic helix-loop-helix protein 4, bHLHc4, Muscle-specific regulatory factor 4,... |
| MW: | 28 kD |
From 90.00€
*
MYF6 PrEST Antigen
Item number: ATA-APrEST96059.100
PrEST Antigen MYF6, Gene description: myogenic factor 6, Alternative Gene Names: bHLHc4, MRF4, Antigen sequence: FETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in muscle differentiation (myogenic...
| Keywords: | MYF6, Myf-6, bHLHc4, BHLHC4, Myogenic factor 6, Muscle-specific regulatory factor 4, Class C basic helix-loop-helix protein 4 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-MYF6, FITC conjugated
Item number: CSB-PA015288LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MYF6. Antigen Species: Human
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MYF6
Item number: CSB-PA015288GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: MYF6. Antigen Species: Human
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Anti-MYF6
Item number: CSB-PA015288LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MYF6. Antigen Species: Human
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Anti-MYF6, HRP conjugated
Item number: CSB-PA015288LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MYF6. Antigen Species: Human
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-MYF6, Biotin conjugated
Item number: CSB-PA015288LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MYF6. Antigen Species: Human
| Keywords: | Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*