- Search results for P01275
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
107 products were found matching "P01275"!
Close filters
Filter by:
No results were found for the filter!
Item number: Cay41255-1
Glucagon-like peptide 1 (GLP-1) (7-13) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460, Cay-24755). It contains several amino acids involved in binding and activation of the GLP-1 receptor (GLP-1R).Formal Name:...
Keywords: | Glucagon-like Peptide 1 (7-13), His-Ala-Glu-Gly-Thr-Phe-Thr-OH,... |
Application: | GLP-1 peptide fragment |
MW: | 761.8 D |
From 74.00€
*
Item number: Cay41256-1
Glucagon-like peptide 1 (GLP-1) (7-15) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460). GLP-1 (7-15) is formed by cleavage of the peptide bond between Asp15 and Val16 in GLP-1 by neprilysin.Formal Name:...
Keywords: | Glucagon-like Peptide 1 (7-15),... |
Application: | GLP-1 peptide fragment |
MW: | 964 D |
From 36.00€
*
Item number: Cay41257-1
Glucagon-like peptide 1 (GLP-1) (7-17) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460).Formal Name: L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-serine, trifluoroacetate salt. Synonyms: Glucagon-like Peptide 1 (7-17)....
Keywords: | Glucagon-like Peptide 1 (7-17),... |
Application: | GLP-1 peptide fragment |
MW: | 1150.2 D |
From 35.00€
*
Item number: Cay41332-10
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1, Cay-24460).Formal Name:...
Keywords: | (S)-N1-((S)-6-amino-1-(((S)-3-hydroxy-1-(((3S,7S)-8-(((S)-3-hydroxy-1-(((2S,3R)-3-hydroxy-1-oxo-1-(((S)-1-oxo-3-phenylprop... |
Application: | GLP-1 derivative |
MW: | 3692.1 D |
From 171.00€
*
Item number: TGM-TMPJ-00742-10ug
Description: Glucagon is a secreted protein and belongs to the glucagon family. Glucagon can be cleved into 8 chains, playing an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon can regulates blood glucose by decreasing glycolysis and increasing gluconeogenesis. In...
Keywords: | OXY, Incretin Hormone, Oxyntomodulin, Glicentin-Related Polypeptide, Glucagon-Like Peptide 2, Glucagon, GCG, GLP-1, GLP-2,... |
MW: | 19 kD |
From 184.00€
*
Item number: CSB-YP009315HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 53-89aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: HSQGTFTSDY SKYLDSRRAQ DFVQWLMNTK RNRNNIA. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form: Liquid or...
Keywords: | Recombinant Human Pro-glucagon (GCG), partial |
Application: | Activity not tested |
Expressed in: | Yeast |
Origin: | human |
MW: | 6.4 kD |
From 292.00€
*
Item number: CSB-EP009315HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 53-89aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: HSQGTFTSDY SKYLDSRRAQ DFVQWLMNTK RNRNNIA. Purity: Greater than 85% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form: Liquid or...
Keywords: | Recombinant Human Pro-glucagon (GCG), partial |
Application: | Activity not tested |
Expressed in: | E.coli |
Origin: | human |
MW: | 30.4 kD |
From 247.00€
*
Item number: CSB-EP009315HUc0.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 53-89aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: HSQGTFTSDY SKYLDSRRAQ DFVQWLMNTK RNRNNIA. Purity: Greater than 85% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form:...
Keywords: | Recombinant Human Pro-glucagon (GCG), partial |
Application: | Activity not tested |
Expressed in: | E.coli |
Origin: | human |
MW: | 34.4 kD |
From 247.00€
*
Item number: CSB-PA002654.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: | GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)... |
Application: | ELISA, WB, IHC, IF |
Host: | Rabbit |
Species reactivity: | human, mouse, rat, monkey |
From 126.00€
*
Item number: CSB-PA132302.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
Keywords: | GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: CSB-PA135172.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
Keywords: | GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: CSB-MA935920.100
Host Species: Mouse. Isotype: IgG2b, Kappa. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from mouse ascites by affinity-chromatography using specific...
Keywords: | Glicentin, Glicentin-related polypeptide, Oxyntomodulin, Glucagon-like peptide 1(GLP-1), Glucagon-like peptide 1(7-37),... |
Application: | ELISA, IHC |
Host: | Mouse |
Species reactivity: | human |
From 167.00€
*