25 products were found matching "O95497"!
No results were found for the filter!
Anti-VNN1
Item number: ATA-HPA046103.100
Polyclonal Antibody against Human VNN1, Gene description: vanin 1, Alternative Gene Names: Tiff66, Validated applications: ICC, Uniprot ID: O95497, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Amidohydrolase that hydrolyzes specifically one of the...
| Keywords: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
VNN1 Protein, Human, Recombinant (His)
Item number: TGM-TMPY-01403-50ug
Description: VNN1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 53.7 kDa and the accession number is O95497.
| Keywords: | vanin 1, Tiff66, HDLCQ8 |
| MW: | 53.7 kD |
319.00€
*
Human Pantetheinase / VNN1 ELISA Kit
Item number: G-HUFI01321.96
| Application: | ELISA |
| Species reactivity: | human |
641.00€
*
Anti-VNN1 / Vanin 1
Item number: ARG59214.50
Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
| Keywords: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
551.00€
*
Anti-VNN1
Item number: E-AB-53205.120
This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity...
| Keywords: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
| Application: | IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 89.00€
*
Human VNN1 (Vanin 1) ELISA Kit
Item number: G-HUES03490.96
ELISA Type: Sandwich. Sensitivity: 0.188ng/mL. Range: 0.313--20ng/mL. Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
| Keywords: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
| Application: | Sandwich ELISA |
| Species reactivity: | human |
641.00€
*
Human VNN1 (Vanin 1) ELISA Kit
Item number: ELK-ELK3314.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human VNN1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human VNN1. Next,...
| Keywords: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
NEW
Recombinant Human Vanin-1/VNN1 Protein
Item number: G-RPCB0228.96
Endotoxin Levels: < 0.1 EU/µg of the protein by LAL method. Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
| Keywords: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
| Expressed in: | Human cells |
| Origin: | human |
641.00€
*
VNN1 PrEST Antigen
Item number: ATA-APrEST95589.100
PrEST Antigen VNN1, Gene description: vanin 1, Alternative Gene Names: Tiff66, Antigen sequence: VFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Amidohydrolase that hydrolyzes specifically one...
| Keywords: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-Vanin1
Item number: E-AB-40574.25
Vanin1 (VNN1) is a member of the biotinidase family and is expressed at the cell surface in epithelial cells . VNN1 is also known as vascular noninflammatory molecule 1. It does not possess biotinidase activity, but is a pantetheinase that catalyzes the hydrolysis of pantetheine to pantothenic acid (vitaminB5) and...
| Keywords: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1, Vanin1 Polyclonal Antibody |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
119.00€
*
Anti-VNN1
Item number: CSB-PA025883GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: VNN1. Antigen Species: Human
| Keywords: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Anti-VNN1
Item number: CSB-PA025883LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: VNN1. Antigen Species: Human
| Keywords: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*