25 products were found matching "O95497"!

1 from 3 pages
No results were found for the filter!
Anti-VNN1
Anti-VNN1

Item number: ATA-HPA046103.100

Polyclonal Antibody against Human VNN1, Gene description: vanin 1, Alternative Gene Names: Tiff66, Validated applications: ICC, Uniprot ID: O95497, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Amidohydrolase that hydrolyzes specifically one of the...
Keywords: Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory...
Application: ICC
Host: Rabbit
Species reactivity: human
477.00€ *
Review
VNN1 Protein, Human, Recombinant (His)
VNN1 Protein, Human, Recombinant (His)

Item number: TGM-TMPY-01403-50ug

Description: VNN1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 53.7 kDa and the accession number is O95497.
Keywords: vanin 1, Tiff66, HDLCQ8
MW: 53.7 kD
319.00€ *
Review
Human Pantetheinase / VNN1 ELISA Kit
Human Pantetheinase / VNN1 ELISA Kit

Item number: G-HUFI01321.96

Application: ELISA
Species reactivity: human
641.00€ *
Review
Anti-VNN1 / Vanin 1
Anti-VNN1 / Vanin 1

Item number: ARG59214.50

Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
Keywords: Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory...
Application: WB
Host: Rabbit
Species reactivity: human
551.00€ *
Review
Anti-VNN1
Anti-VNN1

Item number: E-AB-53205.120

This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity...
Keywords: Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory...
Application: IF, ELISA
Host: Rabbit
Species reactivity: human
From 89.00€ *
Review
Human VNN1 (Vanin 1) ELISA Kit
Human VNN1 (Vanin 1) ELISA Kit

Item number: G-HUES03490.96

ELISA Type: Sandwich. Sensitivity: 0.188ng/mL. Range: 0.313--20ng/mL. Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
Keywords: VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1
Application: Sandwich ELISA
Species reactivity: human
641.00€ *
Review
Human VNN1 (Vanin 1) ELISA Kit
Human VNN1 (Vanin 1) ELISA Kit

Item number: ELK-ELK3314.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human VNN1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human VNN1. Next,...
Keywords: VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1
Application: ELISA
Species reactivity: human
From 374.00€ *
Review
NEW
Recombinant Human Vanin-1/VNN1 Protein
Recombinant Human Vanin-1/VNN1 Protein

Item number: G-RPCB0228.96

Endotoxin Levels: < 0.1 EU/µg of the protein by LAL method. Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
Keywords: VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1
Expressed in: Human cells
Origin: human
641.00€ *
Review
VNN1 PrEST Antigen
VNN1 PrEST Antigen

Item number: ATA-APrEST95589.100

PrEST Antigen VNN1, Gene description: vanin 1, Alternative Gene Names: Tiff66, Antigen sequence: VFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Amidohydrolase that hydrolyzes specifically one...
Keywords: VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1
Expressed in: E.coli
Origin: human
265.00€ *
Review
Anti-Vanin1
Anti-Vanin1

Item number: E-AB-40574.25

Vanin1 (VNN1) is a member of the biotinidase family and is expressed at the cell surface in epithelial cells . VNN1 is also known as vascular noninflammatory molecule 1. It does not possess biotinidase activity, but is a pantetheinase that catalyzes the hydrolysis of pantetheine to pantothenic acid (vitaminB5) and...
Keywords: VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1, Vanin1 Polyclonal Antibody
Application: WB
Host: Rabbit
Species reactivity: human
119.00€ *
Review
Anti-VNN1
Anti-VNN1

Item number: CSB-PA025883GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: VNN1. Antigen Species: Human
Keywords: Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
552.00€ *
Review
Anti-VNN1
Anti-VNN1

Item number: CSB-PA025883LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: VNN1. Antigen Species: Human
Keywords: Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory...
Application: ELISA, WB, IHC, IF
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
1 from 3 pages