- Search results for O15554
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
25 products were found matching "O15554"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA013367.100
Polyclonal Antibody against Human KCNN4, Gene description: potassium calcium-activated channel subfamily N member 4, Alternative Gene Names: hIKCa1, hKCa4, hSK4, IK, KCa3.1, Validated applications: ICC, Uniprot ID: O15554, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
Keywords: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-KCa3.1, Anti-SKCa 4, Anti-Putative Gardos channel,... |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
450.00€
*
Item number: CSB-CF012086HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-427aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MGGDLVLGLG ALRRRKRLLE QEKSLAGWAL VLAGTGIGLM VLHAEMLWFG GCSWALYLFL VKCTISISTF LLLCLIVAFH AKEVQLFMTD NGLRDWRVAL TGRQAAQIVL...
Keywords: | IK1, SK4, KCa4, IKCa1, SKCa4, KCNN4, KCa3.1, SKCa 4, Putative Gardos channel, Intermediate conductance calcium-activated... |
Application: | Activity not tested |
Expressed in: | E.coli in vitro |
Origin: | human |
MW: | 53.7 kD |
From 1,458.00€
*
Item number: CSB-PA484256.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: KCNN4. Antigen Species: Human
Keywords: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA980762.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: KCNN4. Antigen Species: Human
Keywords: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | ELISA, WB, IHC |
Host: | Rabbit |
Species reactivity: | human, mouse |
From 167.00€
*
Item number: E-AB-13359.120
The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded protein may be part of the predominant calcium-activated...
Keywords: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | IHC, ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 89.00€
*
Item number: NSJ-RQ4583
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intermediate conductance calcium-activated potassium channel protein 1 (KCNN4, Kca3.1) is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane...
Keywords: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-KCa3.1, Anti-SKCa 4, Anti-Putative Gardos channel,... |
Application: | WB, Direct ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
772.00€
*
Item number: ARG42195.50
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
Keywords: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-SKCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
551.00€
*
Item number: ATA-HPA053841.100
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
Keywords: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
From 320.00€
*
Item number: ATA-HPA059622.100
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
Keywords: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
From 320.00€
*
Item number: ELK-EA302.50
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization...
Keywords: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-SKCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | WB, IHC |
Host: | Rabbit |
Species reactivity: | human |
173.00€
*
Item number: NSJ-RQ7087
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intermediate conductance calcium-activated potassium channel protein 1 (KCNN4, Kca3.1) is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane...
Keywords: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Application: | WB, Direct ELISA |
Host: | Rabbit |
Species reactivity: | human |
772.00€
*

Item number: ATA-APrEST96183.100
PrEST Antigen KCNN4, Gene description: potassium calcium-activated channel subfamily N member 4, Alternative Gene Names: hIKCa1, hKCa4, hSK4, IK, KCa3.1, Antigen sequence: LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ, Storage: Upon delivery store at...
Keywords: | IK1, SK4, KCa4, KCNN4, SKCa4, IKCa1, KCa3.1, SKCa 4, Putative Gardos channel, Intermediate conductance calcium-activated... |
Expressed in: | E.coli |
Origin: | human |
265.00€
*