21 products were found matching "O15169"!
No results were found for the filter!
Anti-AXIN1
Item number: ABS-KC-1213.100
Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039, PubMed:27098453). Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
| Keywords: | Anti-Axin-1, Anti-Axis inhibition protein 1, Anti-hAxin, AXIN1 Antibody |
| Host: | Mouse |
| Species reactivity: | human |
From 232.00€
*
Anti-AXIN1
Item number: ATA-HPA073924.100
Polyclonal Antibody against Human AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Validated applications: ICC, WB, Uniprot ID: O15169, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the beta-catenin destruction complex...
| Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1 |
| Application: | WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
450.00€
*
Anti-AXIN1
Item number: CSB-PA828936.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
| Keywords: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Anti-AXIN1
Item number: CSB-PA914369.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
| Keywords: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Anti-AXIN1, C-terminal
Item number: ARG63283.100
Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt signaling pathway and ventralize...
| Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1 |
| Application: | ELISA, IHC (paraffin) |
| Host: | Goat |
| Species reactivity: | human |
822.00€
*
Human Axin-1 ELISA Kit
Item number: G-HUFI02140.96
ELISA Type: Sandwich. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma. Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039,...
| Keywords: | AXIN, AXIN1, hAxin, Axin-1, Axis inhibition protein 1 |
| Application: | Sandwich ELISA |
| Species reactivity: | human |
641.00€
*
Anti-AXIN1
Item number: NSJ-R34056-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Axis inhibition protein 1 Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating...
| Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody |
| Application: | IHC, ELISA (peptide) |
| Host: | Goat |
| Species reactivity: | human |
790.00€
*
Anti-AXIN1
Item number: NSJ-F45423-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. AXIN1 is a component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
| Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 350.00€
*
Anti-Axin-1
Item number: NSJ-F41872-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Axin-1 is a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2,...
| Keywords: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, Axin-1 Antibody |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 350.00€
*
AXIN1 (human), recombinant protein
Item number: ABS-PP-690.100
| Keywords: | Axin-1, Axis inhibition protein 1, hAxin, Recombinant Human AXIN1 Protein |
| MW: | 15.5 kD |
From 90.00€
*
AXIN1 PrEST Antigen
Item number: ATA-APrEST95824.100
PrEST Antigen AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Antigen sequence: AWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the beta-catenin destruction...
| Keywords: | AXIN, hAxin, AXIN1, Axin-1, Axis inhibition protein 1 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-AXIN1
Item number: CSB-PA517675LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: AXIN1. Antigen Species: Human
| Keywords: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, AI316800 antibody, AXIN antibody, Axin 1... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*