- Search results for K16316
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "K16316"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA072896.100
Polyclonal Antibody against Human STK31, Gene description: serine/threonine kinase 31, Alternative Gene Names: SgK396, TDRD8, Validated applications: IHC, Uniprot ID: Q9BXU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*
Item number: ATA-HPA023194.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 84%
Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
From 358.00€
*

Item number: ABS-PP-7292.20
Keywords: | Serine/threonine-protein kinase 31, Serine/threonine-protein kinase NYD-SPK, Sugen kinase 396, SgK396, Recombinant Human... |
Expressed in: | E.coli |
Origin: | human |
MW: | 47.5 kD |
From 90.00€
*

Item number: ATA-APrEST95905.100
PrEST Antigen STK31, Gene description: serine/threonine kinase 31, Alternative Gene Names: SgK396, TDRD8, Antigen sequence: DTHYDKVEDVVGSHIEDAVTFWAQSINRNKDIMKIGCSLSEVCPQASSVLGNLDPNKIYGGLFSEDQCWYRCKVLKIISVEKCLVRYIDYGNTEILNRSDIVEIPLELQFSSVAKKYKLWGLH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: | STK31, SgK396, SGK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-CL861165HU.10
Length: 3060 Sequence: atgtgggtcc agggtcactc ttctagagct tccgcaacgg aaagtgtgag tttttcagga attgttcaaa tggatgaaga tacacattac gataaagtgg aagatgtggt tggaagtcac atagaagatg cagtaacatt ttgggcccag agtatcaata gaaataagga tatcatgaag attggttgct cactgtctga agtttgcccc cacgccagtt cagttttggg gaatcttgac ccaaacaaga tttatggtgg...
Keywords: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
Application: | Molecular biology, clone |
Species reactivity: | human |
1,273.00€
*

Item number: 009-001-T62S
Recombinant human STK31 (496-end) was expressed by baculovirus in Sf9 insect cell using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >80% by densitometry.
Keywords: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
Application: | WB |
Expressed in: | Human |
494.00€
*

Item number: S4283-48.200
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. Applications: Suitable for use in ELISA, Western Blot, and Immunohistochemistry. Other...
Keywords: | EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31, Anti-Serine/threonine-protein kinase NYD-SPK |
Application: | ELISA, IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
767.00€
*

Item number: S4283-48A.200
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. Applications: Suitable for use in ELISA, Western Blot, and Immunohistochemistry. Other...
Keywords: | EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31, Anti-Serine/threonine-protein kinase NYD-SPK |
Application: | ELISA, IHC, WB |
Host: | Rabbit |
Species reactivity: | human, rat |
767.00€
*

Item number: G-HUFI06292.96
Human STK31 (Serine/threonine-protein kinase 31) ELISA Kit from Assay Genie is a pre-coated immunoassay with a high sensitivity and broad range and has been designed to measure Human STK31 (Serine/threonine-protein kinase 31) in serum, plasma & cell culture supernatant samples. The Human STK31...
Keywords: | STK31, SgK396, SGK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
Application: | Sandwich ELISA |
Species reactivity: | human |
641.00€
*

Item number: ATA-APrEST75127.100
Buffer: PBS and 1M Urea, pH 7.4.
Keywords: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
Application: | Control antigen |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: G-CAB13106.20
STK31 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Mouse, Rat and for use in WB applications.STK31 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
Application: | WB |
Host: | Rabbit |
Species reactivity: | mouse, rat |
149.00€
*

Item number: ELK-ES10202.100
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008], Recommended dilutions: WB 1:500-2000 ELISA 1:5000-20000....
Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
Application: | WB, ELISA |
Host: | Rabbit |
Species reactivity: | human, rat, mouse, |
From 173.00€
*