13 products were found matching "K16316"!
No results were found for the filter!
Anti-STK31
Item number: ATA-HPA072896.100
Polyclonal Antibody against Human STK31, Gene description: serine/threonine kinase 31, Alternative Gene Names: SgK396, TDRD8, Validated applications: IHC, Uniprot ID: Q9BXU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
| Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-STK31
Item number: ATA-HPA023194.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 84%
| Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 358.00€
*
STK31 (human), recombinant protein
Item number: ABS-PP-7292.20
| Keywords: | Serine/threonine-protein kinase 31, Serine/threonine-protein kinase NYD-SPK, Sugen kinase 396, SgK396, Recombinant Human... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 47.5 kD |
From 90.00€
*
STK31 PrEST Antigen
Item number: ATA-APrEST95905.100
PrEST Antigen STK31, Gene description: serine/threonine kinase 31, Alternative Gene Names: SgK396, TDRD8, Antigen sequence: DTHYDKVEDVVGSHIEDAVTFWAQSINRNKDIMKIGCSLSEVCPQASSVLGNLDPNKIYGGLFSEDQCWYRCKVLKIISVEKCLVRYIDYGNTEILNRSDIVEIPLELQFSSVAKKYKLWGLH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Keywords: | STK31, SgK396, SGK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
STK31 (Vector pUC, Accession No. BC059374)
Item number: CSB-CL861165HU.10
Length: 3060 Sequence: atgtgggtcc agggtcactc ttctagagct tccgcaacgg aaagtgtgag tttttcagga attgttcaaa tggatgaaga tacacattac gataaagtgg aagatgtggt tggaagtcac atagaagatg cagtaacatt ttgggcccag agtatcaata gaaataagga tatcatgaag attggttgct cactgtctga agtttgcccc cacgccagtt cagttttggg gaatcttgac ccaaacaaga tttatggtgg...
| Keywords: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
1,273.00€
*
STK31 protein-GST fusion
Item number: 009-001-T62S
Recombinant human STK31 (496-end) was expressed by baculovirus in Sf9 insect cell using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >80% by densitometry.
| Keywords: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Application: | WB |
| Expressed in: | Human |
494.00€
*
Anti-STK31, CT (Serine/Threonine-protein Kinase 31,...
Item number: S4283-48.200
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. Applications: Suitable for use in ELISA, Western Blot, and Immunohistochemistry. Other...
| Keywords: | EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31, Anti-Serine/threonine-protein kinase NYD-SPK |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
767.00€
*
Anti-STK31, NT (Serine/Threonine-protein Kinase 31,...
Item number: S4283-48A.200
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. Applications: Suitable for use in ELISA, Western Blot, and Immunohistochemistry. Other...
| Keywords: | EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31, Anti-Serine/threonine-protein kinase NYD-SPK |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, rat |
767.00€
*
Human STK31 (Serine/threonine-protein kinase 31) ELISA...
Item number: G-HUFI06292.96
Human STK31 (Serine/threonine-protein kinase 31) ELISA Kit from Assay Genie is a pre-coated immunoassay with a high sensitivity and broad range and has been designed to measure Human STK31 (Serine/threonine-protein kinase 31) in serum, plasma & cell culture supernatant samples. The Human STK31...
| Keywords: | STK31, SgK396, SGK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Application: | Sandwich ELISA |
| Species reactivity: | human |
641.00€
*
STK31 PrEST Antigen
Item number: ATA-APrEST75127.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-STK31
Item number: G-CAB13106.20
STK31 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Mouse, Rat and for use in WB applications.STK31 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | mouse, rat |
149.00€
*
Anti-STK31
Item number: ELK-ES10202.100
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008], Recommended dilutions: WB 1:500-2000 ELISA 1:5000-20000....
| Keywords: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*