27 products were found matching "K00804"!
No results were found for the filter!
Anti-GGPS1
Item number: ATA-HPA050727.100
Polyclonal Antibody against Human GGPS1, Gene description: geranylgeranyl diphosphate synthase 1, Alternative Gene Names: GGPPS1, Validated applications: ICC, WB, Uniprot ID: O95749, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the...
| Keywords: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.29, EC=2.5.1.10, Anti-GGPP synthase,... |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Geranyl pyrophosphate triammonium
Item number: TGM-T35589-1mg
Description: Geranyl pyrophosphate is an intermediate in the mevalonate pathway. It is formed from dimethylallyl pyrophosphate and isopentenyl pyrophosphate by geranyl pyrophosphate synthase. Geranyl pyrophosphate is used in the biosynthesis of farnesyl pyrophosphate , geranylgeranyl pyrophosphate , cholesterol,...
| Application: | Geranyl pyrophosphate synthase metabolite |
| CAS | 116057-55-7 |
| MW: | 365.304 D |
From 323.00€
*
Geranylgeranyl pyrophosphate synthase (GGPS1), human,...
Item number: CSB-EP009393HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-300aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MEKTQETVQR ILLEPYKYLL QLPGKQVRTK LSQAFNHWLK VPEDKLQIII EVTEMLHNAS LLIDDIEDNS KLRRGFPVAH SIYGIPSVIN SANYVYFLGL EKVLTLDHPD AVKLFTRQLL ELHQGQGLDI...
| Keywords: | GGPS1, GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, GGPP synthase, Geranyltranstransferase,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 50.9 kD |
From 219.00€
*
Geranyl Pyrophosphate (triammonium salt)
Item number: Cay63320-1
Geranyl pyrophosphate is an intermediate in the mevalonate pathway. It is formed from dimethylallyl pyrophosphate (DMAPP, Cay-63180) and isopentenyl pyrophosphate by geranyl pyrophosphate synthase. Geranyl pyrophosphate is used in the biosynthesis of farnesyl pyrophosphate (Cay-63250), geranylgeranyl pyrophosphate...
| Keywords: | GDP, Geranyl Diphosphate, GPP, 3E,7-dimethyl-2,6-octadienyl-diphosphoric acid, triammonium salt |
| Application: | Geranyl pyrophosphate synthase metabolite |
| CAS | 116057-55-7 |
| MW: | 365.3 D |
From 178.00€
*
Anti-GGPS1
Item number: ARG41221.100
Protein function: Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins. [The UniProt Consortium]
| Keywords: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.-, EC=2.5.1.1, EC=2.5.1.29, EC=2.5.1.10, Anti-GGPP synthase,... |
| Application: | IHC (paraffin), WB |
| Host: | Rabbit |
| Species reactivity: | human |
616.00€
*
Anti-GGPS1
Item number: ATA-HPA029472.100
Protein function: Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen...
| Keywords: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
NEW
Anti-BTS1
Item number: CSB-PA604898XA01SVG.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-BTS1, Anti-YPL069C, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.29, EC=2.5.1.10, Anti-GGPP synthase,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
From 1,529.00€
*
NEW
Anti-BTS1
Item number: CSB-PA762225XA01DOT.200
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-BTS1, Anti-AEL238C, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
1,529.00€
*
GGPS1 (human), recombinant protein
Item number: ABS-PP-4342.20
| Keywords: | Geranylgeranyl pyrophosphate synthase, GGPP synthase, GGPPSase, (2E, 6E)-farnesyl diphosphate synthase,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 36 kD |
From 90.00€
*
GGPS1 PrEST Antigen
Item number: ATA-APrEST95575.100
PrEST Antigen GGPS1, Gene description: geranylgeranyl diphosphate synthase 1, Alternative Gene Names: GGPPS1, Antigen sequence: HPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | GGPS1, GGPPSase, EC=2.5.1.-, EC=2.5.1.1, EC=2.5.1.29, EC=2.5.1.10, GGPP synthase, Geranyltranstransferase,... |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-GGPS1
Item number: CSB-PA009393GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: GGPS1. Antigen Species: Human
| Keywords: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Anti-GGPS1, HRP conjugated
Item number: CSB-PA009393HB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: GGPS1. Antigen Species: Human
| Keywords: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*