13 products were found matching "GeneID 9033"!

1 from 2 pages
No results were found for the filter!
Anti-PKD2L1
Anti-PKD2L1

Item number: ATA-HPA070002.100

Polyclonal Antibody against Human PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Validated applications: ICC, Uniprot ID: Q9P0L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
Keywords: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Application: ICC
Host: Rabbit
Species reactivity: human
477.00€ *
Review
Anti-PKD2L1
Anti-PKD2L1

Item number: CSB-PA214505.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Keywords: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-PKD2L1
Anti-PKD2L1

Item number: CSB-PA960366.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Keywords: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Human PK2L1 full length protein-synthetic nanodisc
Human PK2L1 full length protein-synthetic nanodisc

Item number: DIM-FLP100773.10

This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Keywords: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Application: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Expressed in: Human cells
Origin: human
MW: 92 kD
From 1,291.00€ *
Review
Human PK2L1-Strep full length protein-synthetic nanodisc
Human PK2L1-Strep full length protein-synthetic nanodisc

Item number: DIM-FLP120773.10

This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Keywords: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Application: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Expressed in: Human cells
Origin: human
MW: 92 kD
From 1,162.00€ *
Review
PKD2L1 (human), recombinant protein
PKD2L1 (human), recombinant protein

Item number: ABS-PP-5501.100

Keywords: Polycystin-2-like protein 1, Polycystin-2L1, Polycystic kidney disease 2-like 1 protein, Polycystin-2 homolog,...
MW: 29.5 kD
From 90.00€ *
Review
PKD2L1 PrEST Antigen
PKD2L1 PrEST Antigen

Item number: ATA-APrEST96085.100

PrEST Antigen PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Antigen sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Expressed in: E.coli
Origin: human
265.00€ *
Review
Anti-PKD2L1
Anti-PKD2L1

Item number: CSB-PA865199DSR2HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Keywords: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-PKD2L1
Anti-PKD2L1

Item number: CSB-PA018062GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Keywords: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
552.00€ *
Review
PKD2L1 (Vector pUC, Accession No. BC025665)
PKD2L1 (Vector pUC, Accession No. BC025665)

Item number: CSB-CL865199HU.10

Length: 2418 Sequence: atgaatgctg tgggaagtcc tgaggggcag gagctgcaaa agctggggag tggagcctgg gacaaccccg cctacagtgg tcccccttcc ccacacggga cgctgagagt ctgcaccatc tccagcacgg ggcctctcca gccccaaccc aagaagcctg aagatgaacc ccaggagacg gcatacagga cccaggtgtc cagctgctgc ctccatatct gtcaaggcat cagaggactt tggggaacaa ccctgactga...
Keywords: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Application: Molecular biology, clone
Species reactivity: human
879.00€ *
Review
PKD2L1, Human polycystic kidney disease 2-like 1, Real Time PCR Primer Set
PKD2L1, Human polycystic kidney disease 2-like 1, Real...

Item number: VHPS-6930

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: PKD2L, PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Application: RNA quantification
44.00€ *
Review
Anti-PKD2L1, NT (PKD2L1, PKD2L, PKDL, Polycystic kidney disease 2-like 1 protein, Polycystin-2 homol
Anti-PKD2L1, NT (PKD2L1, PKD2L, PKDL, Polycystic kidney...

Item number: 040096.200

PKD2L1 is a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel....
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
767.00€ *
Review
1 from 2 pages