10 products were found matching "GeneID 8911"!

No results were found for the filter!
Anti-CACNA1I
Anti-CACNA1I

Item number: ATA-HPA066992.100

Polyclonal Antibody against Human CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I, Alternative Gene Names: Cav3.3, Validated applications: ICC, Uniprot ID: Q9P0X4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Voltage-sensitive...
Keywords: Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,...
Application: ICC
Host: Rabbit
Species reactivity: human
477.00€ *
Review
Anti-CACNA1I
Anti-CACNA1I

Item number: CSB-PA413190.50

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using specific immunogen....
Keywords: Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
126.00€ *
Review
Anti-CACNA1I
Anti-CACNA1I

Item number: G-PACO07169.50

CACNA1I Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, IHC applications. CACNA1I Antibody is a high quality polyclonal antibody for research use only.. Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions...
Keywords: Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
341.00€ *
Review
Anti-Cav3.3
Anti-Cav3.3

Item number: ELK-EA273.50

Voltage-gated Ca2+ channels (CaV), enable the passage of Ca2+ ions in a voltage dependent manner. These heteromeric entities are formed in part by the pore-forming alpha1 subunit which determines the biophysical and pharmacological properties of the channel. Protein function: Voltage-sensitive calcium channels...
Keywords: Anti-CACNA1I, Anti-Ca(v)3.3, Anti-KIAA1120, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,...
Application: IHC
Host: Rabbit
Species reactivity: human
173.00€ *
Review
Human CAC1-Strep full length protein-synthetic nanodisc
Human CAC1-Strep full length protein-synthetic nanodisc

Item number: DIM-FLP120744.10

This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation...
Keywords: CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel...
Application: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Expressed in: Human cells
Origin: human
MW: 245.1 kD
From 1,162.00€ *
Review
Human CAC1 full length protein-synthetic nanodisc
Human CAC1 full length protein-synthetic nanodisc

Item number: DIM-FLP100744.10

This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation...
Keywords: CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel...
Application: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Expressed in: Human cells
Origin: human
MW: 245.1 kD
From 1,291.00€ *
Review
CACNA1I (human), recombinant protein
CACNA1I (human), recombinant protein

Item number: ABS-PP-4567.100

Keywords: Voltage-dependent T-type calcium channel subunit alpha-1I, Voltage-gated calcium channel subunit alpha Cav3.3, Ca(v)3.3,...
MW: 10 kD
From 90.00€ *
Review
CACNA1I PrEST Antigen
CACNA1I PrEST Antigen

Item number: ATA-APrEST95994.100

PrEST Antigen CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I, Alternative Gene Names: Cav3.3, Antigen sequence: HHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel...
Expressed in: E.coli
Origin: human
265.00€ *
Review
CACNA1I, Human calcium channel, voltage-dependent, T type, alpha 1I subunit, Real Time PCR Primer Se
CACNA1I, Human calcium channel, voltage-dependent, T...

Item number: VHPS-1453

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: CACNA1I, Ca(v)3.3, KIAA1120, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel...
Application: RNA quantification
44.00€ *
Review
Anti-Cav3.3
Anti-Cav3.3

Item number: ELK-ES20794.100

calcium voltage-gated channel subunit alpha1 I(CACNA1I) Homo sapiens This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this...
Keywords: Anti-CACNA1I, Anti-Ca(v)3.3, Anti-KIAA1120, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,...
Application: IHC, IF
Host: Rabbit
Species reactivity: human, rat, mouse
From 173.00€ *
Review