- Search results for GeneID 7771
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
6 products were found matching "GeneID 7771"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA076887.100
Polyclonal Antibody against Human ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Validated applications: ICC, Uniprot ID: Q9UJU3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
Keywords: | Anti-ZFP112, Anti-ZNF112, Anti-Zfp-112, Anti-Zinc finger protein 112, Anti-Zinc finger protein 228 |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*

Item number: ABS-PP-3468.100
Keywords: | Zinc finger protein 112, Zfp-112, Zinc finger protein 228, Recombinant Human ZNF112 Protein |
MW: | 28.5 kD |
From 90.00€
*

Item number: ATA-APrEST95699.100
PrEST Antigen ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Antigen sequence: SVSWLSHHNDKLEVHRKENYSCHDCGEDIMKVSLLNQESIQTEEKPYPCTGYRKAFSNDSSSEVHQQFHLEGKPYTYSSCGKGC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved...
Keywords: | ZNF112, ZFP112, Zfp-112, Zinc finger protein 112, Zinc finger protein 228 |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-CL891528HU.10
Length: 2724 Sequence: atggtgacat tcaaggatgt tgctgtggtc ttcactgagg aggagctggg gctgctggac tctgtccaga ggaagctgta ccgagatgtg atgctggaga acttcaggaa cctgctctta gtagcacatc agcccttcaa gccagaccta atatcccagc tggagagaga agaaaagctt ttgatggtgg agacagaaac cccaagggat ggatgttcag gaaggaagaa tcaacaaaag atggagagta ttcaggaagt...
Keywords: | Zinc finger protein 112 homolog (Mouse) |
Application: | Molecular biology, clone |
Species reactivity: | human |
588.00€
*

Item number: VHPS-10208
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | ZNF228, ZFP112, Zfp-112, Zinc finger protein 228, Zinc finger protein 112 homolog |
Application: | RNA quantification |
44.00€
*

Item number: ELK-ES12214.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
Keywords: | Anti-ZFP112, Anti-ZNF112, Anti-Zfp-112, Anti-Zinc finger protein 112, Anti-Zinc finger protein 228, ZF112 rabbit pAb |
Application: | WB |
Host: | Rabbit |
Species reactivity: | human, mouse |
From 173.00€
*