6 products were found matching "GeneID 7771"!
No results were found for the filter!
Anti-ZNF112
Item number: ATA-HPA076887.100
Polyclonal Antibody against Human ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Validated applications: ICC, Uniprot ID: Q9UJU3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
| Keywords: | Anti-ZFP112, Anti-ZNF112, Anti-Zfp-112, Anti-Zinc finger protein 112, Anti-Zinc finger protein 228 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
ZNF112 (human), recombinant protein
Item number: ABS-PP-3468.100
| Keywords: | Zinc finger protein 112, Zfp-112, Zinc finger protein 228, Recombinant Human ZNF112 Protein |
| MW: | 28.5 kD |
From 90.00€
*
ZNF112 PrEST Antigen
Item number: ATA-APrEST95699.100
PrEST Antigen ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Antigen sequence: SVSWLSHHNDKLEVHRKENYSCHDCGEDIMKVSLLNQESIQTEEKPYPCTGYRKAFSNDSSSEVHQQFHLEGKPYTYSSCGKGC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved...
| Keywords: | ZNF112, ZFP112, Zfp-112, Zinc finger protein 112, Zinc finger protein 228 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
ZFP112 (Vector Vector will be determined during the...
Item number: CSB-CL891528HU.10
Length: 2724 Sequence: atggtgacat tcaaggatgt tgctgtggtc ttcactgagg aggagctggg gctgctggac tctgtccaga ggaagctgta ccgagatgtg atgctggaga acttcaggaa cctgctctta gtagcacatc agcccttcaa gccagaccta atatcccagc tggagagaga agaaaagctt ttgatggtgg agacagaaac cccaagggat ggatgttcag gaaggaagaa tcaacaaaag atggagagta ttcaggaagt...
| Keywords: | Zinc finger protein 112 homolog (Mouse) |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
588.00€
*
ZNF228, Human, Real Time PCR Primer Set
Item number: VHPS-10208
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | ZNF228, ZFP112, Zfp-112, Zinc finger protein 228, Zinc finger protein 112 homolog |
| Application: | RNA quantification |
44.00€
*
Anti-ZF112
Item number: ELK-ES12214.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
| Keywords: | Anti-ZFP112, Anti-ZNF112, Anti-Zfp-112, Anti-Zinc finger protein 112, Anti-Zinc finger protein 228, ZF112 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*