12 products were found matching "GeneID 7769"!
No results were found for the filter!
Anti-ZNF226
Item number: ATA-HPA069192.100
Polyclonal Antibody against Human ZNF226, Gene description: zinc finger protein 226, Validated applications: IHC, Uniprot ID: Q9NYT6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]...
| Keywords: | Anti-ZNF226, Anti-Zinc finger protein 226 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-ZNF226
Item number: G-PACO31216.50
ZNF226 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ZNF226 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | Anti-ZNF226, Anti-Zinc finger protein 226 |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
384.00€
*
Anti-ZNF226
Item number: ATA-HPA006145.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 44% and to rat: 47%
| Keywords: | Anti-ZNF226, Anti-Zinc finger protein 226 |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 358.00€
*
ZNF226 (human), recombinant protein
Item number: ABS-PP-2853.100
| Keywords: | Zinc finger protein 226, Recombinant Human ZNF226 Protein |
| MW: | 16 kD |
From 90.00€
*
ZNF226 PrEST Antigen
Item number: ATA-APrEST96237.100
PrEST Antigen ZNF226, Gene description: zinc finger protein 226, Antigen sequence: QRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGHK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]...
| Keywords: | ZNF226, Zinc finger protein 226 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-ZNF226
Item number: CSB-PA026594LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
| Keywords: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF226, HRP conjugated
Item number: CSB-PA026594LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
| Keywords: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody, HRP conjugated |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF226, Biotin conjugated
Item number: CSB-PA026594LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
| Keywords: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody, Biotin conjugated |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF226, FITC conjugated
Item number: CSB-PA026594LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
| Keywords: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody, FITC conjugated |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
ZNF226 (Vector Vector will be determined during the...
Item number: CSB-CL026594HU.10
Length: 285 Sequence: atgaatatgt tcaaggaagc agtgaccttc aaggacgtgg ctgtggcctt cacggaggag gaattggggc tgctgggccc tgcccagagg aagctgtacc gagatgtgat ggtggagaac tttaggaacc tgctgtcagt ggggcatcca cccttcaaac aagatgtatc acctatagaa agaaatgagc agctttggat aatgacgaca gcaacccgaa gacagggaaa tttagatacc ttacttgtaa aagctctttt...
| Keywords: | ZNF226, Zinc finger protein 226 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
ZNF226, Human zinc finger protein 226, Real Time PCR...
Item number: VHPS-10207
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | ZNF226, Zinc finger protein 226 |
| Application: | RNA quantification |
44.00€
*
ZNF226 PrEST Antigen
Item number: ATA-APrEST83534.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ZNF226, Zinc finger protein 226 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*