3 products were found matching "GeneID 7757"!
No results were found for the filter!
Anti-ZNF208
Item number: ATA-HPA077100.100
Polyclonal Antibody against Human ZNF208, Gene description: zinc finger protein 208, Alternative Gene Names: PMIDP, ZNF95, Validated applications: ICC, Uniprot ID: O43345, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
| Keywords: | Anti-ZNF208, Anti-ZNF91L, Anti-Zinc finger protein 208, Anti-Zinc finger protein 91-like |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
ZNF208 PrEST Antigen
Item number: ATA-APrEST96218.100
PrEST Antigen ZNF208, Gene description: zinc finger protein 208, Alternative Gene Names: PMIDP, ZNF95, Antigen sequence: KVILRRYKIHHHACELGPIMNHHPTCGQMHI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]...
| Keywords: | ZNF208, ZNF91L, Zinc finger protein 208, Zinc finger protein 91-like |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
ZNF208, Human zinc finger protein 208, Real Time PCR...
Item number: VHPS-10196
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | GeneID 7757, qPCR, gene expression analysis |
| Application: | RNA quantification |
44.00€
*
