14 products were found matching "GeneID 7728"!
No results were found for the filter!
Anti-ZNF175
Item number: ATA-HPA074615.100
Polyclonal Antibody against Human ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Validated applications: ICC, Uniprot ID: Q9Y473, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Down-regulates the expression of several...
| Keywords: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Zinc finger protein 175 (ZNF175), human, recombinant
Item number: CSB-EP026556HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-711aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPADVNLSQK PQVLGPEKQD GSCEASVSFE DVTVDFSREE WQQLDPAQRC LYRDVMLELY SHLFAVGYHI PNPEVIFRML KEKEPRVEEA EVSHQRCQER EFGLEIPQKE ISKKASFQKD MVGEFTRDGS...
| Keywords: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18, Recombinant Human Zinc finger protein 175 (ZNF175) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 97.6 kD |
From 219.00€
*
Anti-ZNF175
Item number: G-PACO31172.50
ZNF175 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ZNF175 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Down-regulates the expression of several chemokine receptors. Interferes with HIV-1...
| Keywords: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18 |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
384.00€
*
Anti-ZNF175
Item number: ATA-HPA002717.100
Protein function: Down-regulates the expression of several chemokine receptors. Interferes with HIV-1 replication by suppressing Tat-induced viral LTR promoter activity. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to...
| Keywords: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18 |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 239.00€
*
ZNF175 (human), recombinant protein
Item number: ABS-PP-9525.100
| Keywords: | Zinc finger protein 175, Zinc finger protein OTK18, Recombinant Human ZNF175 Protein |
| MW: | 16.5 kD |
From 90.00€
*
ZNF175 PrEST Antigen
Item number: ATA-APrEST95863.100
PrEST Antigen ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Antigen sequence: LYSHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Down-regulates the expression of...
| Keywords: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18 |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-ZNF175
Item number: CSB-PA026556LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
| Keywords: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF175, FITC conjugated
Item number: CSB-PA026556LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
| Keywords: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF175, HRP conjugated
Item number: CSB-PA026556LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
| Keywords: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ZNF175, Biotin conjugated
Item number: CSB-PA026556LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF175. Antigen Species: Human
| Keywords: | Anti-ZNF175, Anti-Zinc finger protein 175, Anti-Zinc finger protein OTK18, OTK18 antibody, Zinc finger protein 175... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
ZNF175 (Vector Vector will be determined during the...
Item number: CSB-CL026556HU.10
Length: 2136 Sequence: atgcctgctg atgtgaattt atcccagaag cctcaggtcc tgggtccaga gaagcaggat ggatcttgcg aggcatcagt gtcatttgag gacgtgaccg tggacttcag cagggaggag tggcagcaac tggaccctgc ccagagatgc ctgtaccggg atgtgatgct ggagctctat agccatctct tcgcagtggg gtatcacatt cccaacccag aggtcatctt cagaatgcta aaagaaaagg agccgcgtgt...
| Keywords: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
482.00€
*
ZNF175, Human zinc finger protein 175, Real Time PCR...
Item number: VHPS-10183
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | ZNF175, Zinc finger protein 175, Zinc finger protein OTK18 |
| Application: | RNA quantification |
44.00€
*