18 products were found matching "GeneID 2983"!

1 from 2 pages
No results were found for the filter!
Anti-GUCY1B1
Anti-GUCY1B1

Item number: ATA-HPA077706.100

Polyclonal Antibody against Human GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Validated applications: ICC, Uniprot ID: Q02153, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
Keywords: Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase...
Application: ICC
Host: Rabbit
Species reactivity: human
477.00€ *
Review
Anti-GUCY1B3
Anti-GUCY1B3

Item number: CSB-PA002672.50

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
126.00€ *
Review
Anti-GUCY1B3
Anti-GUCY1B3

Item number: CSB-PA214476.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Keywords: Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase...
Application: ELISA, WB, IHC, IF
Host: Rabbit
Species reactivity: human, mouse, rat
283.00€ *
Review
Anti-Guanylyl Cyclase beta
Anti-Guanylyl Cyclase beta

Item number: ARG59608.100

Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium]
Keywords: Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase...
Application: WB
Host: Rabbit
Species reactivity: mouse, rat
658.00€ *
Review
Anti-GUCY1B3
Anti-GUCY1B3

Item number: ATA-HPA020870.100

Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
Keywords: Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase...
Application: IHC, WB
Host: Rabbit
Species reactivity: human
From 320.00€ *
Review
Human GUCY1b3 (Guanylate Cyclase 1 Beta 3) ELISA Kit
Human GUCY1b3 (Guanylate Cyclase 1 Beta 3) ELISA Kit

Item number: ELK-ELK4914.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GUCY1b3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GUCY1b3....
Keywords: GUC1B3, GCS-beta-3, GCS-beta-1, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-3,...
Application: ELISA
Species reactivity: human
From 374.00€ *
Review
GUCY1B1 (human), recombinant protein
GUCY1B1 (human), recombinant protein

Item number: ABS-PP-4473.100

Keywords: Guanylate cyclase soluble subunit beta-1, GCS-beta-1, Guanylate cyclase soluble subunit beta-3, GCS-beta-3, Soluble...
MW: 24 kD
From 90.00€ *
Review
GUCY1B1 PrEST Antigen
GUCY1B1 PrEST Antigen

Item number: ATA-APrEST95569.100

PrEST Antigen GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Antigen sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL, Storage: Upon delivery...
Keywords: GUC1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-1,...
Expressed in: E.coli
Origin: human
265.00€ *
Review
Anti-GUCY1B3
Anti-GUCY1B3

Item number: CSB-PA010052GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: GUCY1B1. Antigen Species: Human
Keywords: Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase...
Application: ELISA, WB, IF
Host: Rabbit
Species reactivity: human, mouse, rat
552.00€ *
Review
GUCY1B3, Human guanylate cyclase 1, soluble, beta 3, Real Time PCR Primer Set
GUCY1B3, Human guanylate cyclase 1, soluble, beta 3, Real...

Item number: VHPS-3930

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: GUC1B3, GUCY1B3, EC=4.6.1.2, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble...
Application: RNA quantification
44.00€ *
Review
Anti-Guanylate Cyclase beta-1, Soluble (GCS-beta-1, GC-S-beta-1, GUCY1B1, Guanylate Cyclase 1 Solubl
Anti-Guanylate Cyclase beta-1, Soluble (GCS-beta-1,...

Item number: G9804-50B.200

Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha and a beta subunit, catalyzes the conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs. Applications: Suitable for use in ELISA and Western Blot. Other...
Keywords: EC=4.6.1.2, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase soluble subunit beta-3, Anti-Guanylate...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
767.00€ *
Review
Guanylate Cyclase 1 Beta 3 (GUCY1b3) BioAssay(TM) ELISA Kit (Human)
Guanylate Cyclase 1 Beta 3 (GUCY1b3) BioAssay(TM) ELISA...

Item number: 152637.96

Guanylate Cyclase 1 Beta 3 (GUCY1b3) BioAssay(TM) ELISA Kit (Human) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Guanylate Cyclase 1 Beta 3 (GUCY1b3). Standards or samples are then added to the appropriate microtiter plate wells with a...
Keywords: GUC1B3, GUCY1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit...
Application: ELISA
Species reactivity: human
1,022.00€ *
Review
1 from 2 pages