- Search results for GeneID 2983
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
18 products were found matching "GeneID 2983"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA077706.100
Polyclonal Antibody against Human GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Validated applications: ICC, Uniprot ID: Q02153, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
Keywords: | Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*
Item number: CSB-PA002672.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Application: | ELISA, WB, IHC |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
126.00€
*
Item number: CSB-PA214476.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Keywords: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Application: | ELISA, WB, IHC, IF |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
283.00€
*
Item number: ARG59608.100
Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium]
Keywords: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Application: | WB |
Host: | Rabbit |
Species reactivity: | mouse, rat |
658.00€
*
Item number: ATA-HPA020870.100
Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
Keywords: | Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Application: | IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
From 320.00€
*
Item number: ELK-ELK4914.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GUCY1b3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GUCY1b3....
Keywords: | GUC1B3, GCS-beta-3, GCS-beta-1, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-3,... |
Application: | ELISA |
Species reactivity: | human |
From 374.00€
*

Item number: ABS-PP-4473.100
Keywords: | Guanylate cyclase soluble subunit beta-1, GCS-beta-1, Guanylate cyclase soluble subunit beta-3, GCS-beta-3, Soluble... |
MW: | 24 kD |
From 90.00€
*

Item number: ATA-APrEST95569.100
PrEST Antigen GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Antigen sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL, Storage: Upon delivery...
Keywords: | GUC1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-1,... |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-PA010052GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: GUCY1B1. Antigen Species: Human
Keywords: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Application: | ELISA, WB, IF |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
552.00€
*

Item number: VHPS-3930
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | GUC1B3, GUCY1B3, EC=4.6.1.2, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble... |
Application: | RNA quantification |
44.00€
*

Item number: G9804-50B.200
Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha and a beta subunit, catalyzes the conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs. Applications: Suitable for use in ELISA and Western Blot. Other...
Keywords: | EC=4.6.1.2, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase soluble subunit beta-3, Anti-Guanylate... |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
767.00€
*

Item number: 152637.96
Guanylate Cyclase 1 Beta 3 (GUCY1b3) BioAssay(TM) ELISA Kit (Human) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Guanylate Cyclase 1 Beta 3 (GUCY1b3). Standards or samples are then added to the appropriate microtiter plate wells with a...
Keywords: | GUC1B3, GUCY1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit... |
Application: | ELISA |
Species reactivity: | human |
1,022.00€
*