- Search results for GeneID 215274
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
9 products were found matching "GeneID 215274"!
Close filters
Filter by:
No results were found for the filter!
Item number: CR-C02041-100UG
Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY EQTTRFTFFQ RSLGSAFRLE AAACPGWFLC GPAEPQQPVQ LTKESEPSTH with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine with...
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
Expressed in: | E.coli |
Origin: | mouse |
From 108.00€
*
Item number: ARG82064.96
Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
Application: | ELISA |
Species reactivity: | mouse |
1,056.00€
*
Item number: AG-40B-0227-3010
IL-38 (IL-1F10) belongs to the IL-1 family of proteins. IL-38 is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-38 in the inflammatory response. It has been reported that removal of the N-terminus...
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
Application: | Bioassays |
Expressed in: | Human cells |
Origin: | mouse |
MW: | ~52+28 kD |
From 429.00€
*
NEW
![Mouse IL-38 Recombinant Protein (N-His) Mouse IL-38 Recombinant Protein (N-His)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: G-RPES6706.20
Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T- cells in response to heat-killed Candida albicans. Reduces IL36G- induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
Expressed in: | E.coli |
Origin: | mouse |
395.00€
*
![Interleukin-38 (IL-38), (mouse, rec.), (FLAG) Interleukin-38 (IL-38), (mouse, rec.), (FLAG)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: AG-40B-0101-C010
IL-38 [IL-1F10] (mouse) (aa 3-152) is fused at the C-terminus o a FLAG®-tag. IL-38 (IL-1F10) mRNA is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-1F10 in the inflammatory response.
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
Application: | Bioassays |
Expressed in: | E.coli |
Origin: | mouse |
MW: | 20 kD |
From 352.00€
*
![Il1F10, Mouse interleukin 1 family, member 10, Real Time PCR Primer Set Il1F10, Mouse interleukin 1 family, member 10, Real Time PCR Primer Set](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: VMPS-3073
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Il1f10, Interleukin 1 family, member 10 |
Application: | RNA quantification |
43.00€
*
![Il1f10, Recombinant, Mouse, aa1-152, His-SUMO-Tag (Interleukin-1 Family Member 10) Il1f10, Recombinant, Mouse, aa1-152, His-SUMO-Tag (Interleukin-1 Family Member 10)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: 373808.20
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
MW: | 33,1 |
From 537.00€
*
![Il1f10, Recombinant, Mouse, aa1-152, His-Tag (Interleukin-1 Family Member 10) Il1f10, Recombinant, Mouse, aa1-152, His-Tag (Interleukin-1 Family Member 10)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: 373809.100
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
MW: | 19,1 |
From 497.00€
*
![IL-38 protein(N-His) (recombinant mouse) IL-38 protein(N-His) (recombinant mouse)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: E-PKSM041483.100
Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with immunomodulatory...
Keywords: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse IL-38 protein(N-His) |
Expressed in: | E.coli |
Origin: | mouse |
MW: | 17.9 kD |
From 295.00€
*