24 products were found matching "GeneID 102725035"!
No results were found for the filter!
Anti-LILRB3
Item number: ATA-HPA026985.100
Polyclonal Antibody against Human LILRB3, Gene description: leukocyte immunoglobulin like receptor B3, Alternative Gene Names: CD85a, HL9, ILT5, LIR-3, LIR3, PIR-B, PIRB, Validated applications: ICC, Uniprot ID: O75022, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Keywords: | Anti-ILT5, Anti-CD85a, Anti-LIR-3, Anti-ILT-5, Anti-LILRB3, Anti-Monocyte inhibitory receptor HL9,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
LILRB3/CD85a Protein, Human, Recombinant (His & Avi)
Item number: TGM-TMPK-00354-100ug
Description: Leukocyte immunoglobulin-like receptor subfamily B (LILRB3), also known as ILT5, LIR3, and CD85a, is an immunoglobulin superfamily member that is involved in immune regulation. Subfamily B members have cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) that inhibit signaling events via...
| Keywords: | HL9, LIR3CD85A, LILRB3, PIRB, LIR-3MGC138403, CD85a, ILT5, ILT-5, LIR3 |
| MW: | 50 kD |
From 417.00€
*
LILRB3/CD85a Protein, Human, Recombinant (His & Avi),...
Item number: TGM-TMPK-00355-100ug
Description: Leukocyte immunoglobulin-like receptor subfamily B (LILRB3), also known as ILT5, LIR3, and CD85a, is an immunoglobulin superfamily member that is involved in immune regulation. Subfamily B members have cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) that inhibit signaling events via...
| Keywords: | ILT5, LIR3CD85A, HL9, LIR3, LILRB3, CD85a, ILT-5, PIRB, LIR-3MGC138403 |
| MW: | 50 kD |
From 814.00€
*
LILRB3/CD85a Protein, Human, Recombinant (His), Biotinylated
Item number: TGM-TMPY-05228-100ug
Description: LILRB3/CD85a Protein, Human, Recombinant (His), Biotinylated is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 47.6 kDa and the accession number is O75022-1.
| Keywords: | MGC138403, CD85A, XXbac-BCX105G6.7, LIR3, HL9, LIR-3, ILT5, ILT-5, leukocyte immunoglobulin like receptor B3, LILRA6, PIRB |
| MW: | 47.6 kD |
From 304.00€
*
Anti-LILRB3
Item number: CSB-PA888287.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: LILRB3. Antigen Species: Human
| Keywords: | Anti-ILT5, Anti-ILT-5, Anti-LIR-3, Anti-CD85a, Anti-LILRB3, Anti-Immunoglobulin-like transcript 5, Anti-Monocyte... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Recombinant Human LILRB3 protein (His tag)
Item number: G-RPES9234.96
Endotoxin Levels: < 1.0 EU/mg of the protein as determined by the LAL method. Protein function: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting...
| Keywords: | ILT5, LIR-3, ILT-5, CD85a, LILRB3, Immunoglobulin-like transcript 5, Monocyte inhibitory receptor HL9, CD85 antigen-like... |
| Expressed in: | Human cells |
| Origin: | human |
748.00€
*
Biotinylated Recombinant Human LILRB3/ILT-5/CD85a Protein
Item number: G-RPCB0012.96
Endotoxin Levels: < 1 EU/µg of the protein by LAL method. Protein function: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its...
| Keywords: | ILT5, LIR-3, ILT-5, CD85a, LILRB3, Immunoglobulin-like transcript 5, Monocyte inhibitory receptor HL9, CD85 antigen-like... |
| Origin: | human |
641.00€
*
Biotinylated Recombinant Human LILRB3/ILT-5/CD85a Protein
Item number: G-RPCB2088.96
Protein function: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine- based inhibitor motifs (ITIM). [The...
| Keywords: | ILT5, LIR-3, ILT-5, CD85a, LILRB3, Immunoglobulin-like transcript 5, Monocyte inhibitory receptor HL9, CD85 antigen-like... |
| Origin: | human |
641.00€
*
Recombinant Human LILRB3/ILT-5/CD85a Protein
Item number: G-RPCB1429.96
Endotoxin Levels: <1EU/µg Protein function: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine- based...
| Keywords: | ILT5, LIR-3, ILT-5, CD85a, LILRB3, Immunoglobulin-like transcript 5, Monocyte inhibitory receptor HL9, CD85 antigen-like... |
| Expressed in: | Human cells |
| Origin: | human |
641.00€
*
LILRB3 (human), recombinant protein
Item number: ABS-PP-1955.100
| Keywords: | Leukocyte immunoglobulin-like receptor subfamily B member 3, LIR-3, Leukocyte immunoglobulin-like receptor 3, CD85... |
| MW: | 18.5 kD |
From 90.00€
*
LILRB3 (human), recombinant protein
Item number: ABS-PQ-142.100
| Keywords: | Leukocyte immunoglobulin-like receptor subfamily B member 3, LIR-3, Leukocyte immunoglobulin-like receptor 3, CD85... |
| MW: | 47 kD |
From 270.00€
*
LILRB3 PrEST Antigen
Item number: ATA-APrEST96134.100
PrEST Antigen LILRB3, Gene description: leukocyte immunoglobulin like receptor B3, Alternative Gene Names: CD85a, HL9, ILT5, LIR-3, LIR3, PIR-B, PIRB, Antigen sequence: CHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPS, Storage: Upon delivery...
| Keywords: | ILT5, ILT-5, CD85a, LIR-3, LILRB3, Monocyte inhibitory receptor HL9, Immunoglobulin-like transcript 5, CD85 antigen-like... |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*