- Search results for G1SLF2
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
7 products were found matching "G1SLF2"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-EP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH HMA....
Keywords: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
Application: | Activity not tested |
Expressed in: | E.coli |
Origin: | rabbit |
MW: | 42.3 kD |
From 354.00€
*
Item number: CSB-YP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: Yeast. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH...
Keywords: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
Application: | Activity not tested |
Expressed in: | Yeast |
Origin: | rabbit |
MW: | 17.3 kD |
From 395.00€
*
Item number: DIY0963U-003
The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
Keywords: | IL17A |
Application: | ELISA |
Species reactivity: | rabbit |
From 1,056.00€
*
Item number: KP0961U-100
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Keywords: | IL17A |
Application: | WB, ELISA |
Host: | Chicken |
Species reactivity: | rabbit |
521.00€
*
Item number: KPB0962U-050
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Keywords: | IL17A |
Application: | WB, ELISA |
Host: | Chicken |
Species reactivity: | rabbit |
535.00€
*
![Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A Protein) Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A Protein)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: 373794.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
Keywords: | Interleukin 17A |
MW: | 17,3 |
From 675.00€
*
![IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a) IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: 373779.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
Keywords: | Interleukin 17A |
MW: | 42,3 |
From 636.00€
*