ZNF175 PrEST Antigen

ZNF175 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95863.100 100 µl

7 - 10 business days*

265.00€
 
PrEST Antigen ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18,... more
Product information "ZNF175 PrEST Antigen"
PrEST Antigen ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Antigen sequence: LYSHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Down-regulates the expression of several chemokine receptors. Interferes with HIV-1 replication by suppressing Tat-induced viral LTR promoter activity. [The UniProt Consortium] Mouse gene identity: 51% Rat gene identity: 51%
Keywords: ZNF175, Zinc finger protein 175, Zinc finger protein OTK18
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95863

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZNF175 PrEST Antigen"
Write a review
or to review a product.
Viewed