Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
![WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag (Bromodomain and WD Repeat Domain Containing 1,](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
298492.100 | 100 µg | - | - |
3 - 19 business days* |
916.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved... more
Product information "WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag (Bromodomain and WD Repeat Domain Containing 1,"
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates multiple transcript variants encoding distinct isoforms. In mouse, this gene encodes a nuclear protein that has a polyglutamine-containing region that functions as a transcriptional activation domain which may regulate chromatin remodelling and associates with a component of the SWI/SNF chromatin remodelling complex.[provided by RefSeq, Jun 2011]. Source: Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human bromodomain and WD repeat domain containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.2kD, AA Sequence: MHHHHHHIRATNYVESNWKKQCKELVNLIF, QCEDSEPFRQPVDLVEYPDYRDIIDTPMDF, GTVRETLDAGNYDSPLEFCKDIRLIFSNAKA, YTPNKRSKIYSMTLRLSALFEEKMKKISSDFK, IGQKFNEKLRRSQ, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: | BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1 |
Supplier: | United States Biological |
Supplier-Nr: | 298492 |
Properties
Conjugate: | No |
MW: | 16,2 |
Format: | Purified |
Database Information
KEGG ID : | K11798 | Matching products |
UniProt ID : | Q9NSI6 | Matching products |
Gene ID | GeneID 54014 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | -80°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed