TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)

TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375519.20 20 µg - -

3 - 19 business days*

497.00€
375519.100 100 µg - -

3 - 19 business days*

777.00€
 
Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards... more
Product information "TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)"
Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin. Source: Recombinant protein corresponding to aa1-406 from mouse TDO2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~49.8kD, AA Sequence: MSGCPFAGNSVGYTLKNVSMEDNEEDRAQTGVNRASKGGLIYGNYLQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPNGFNFWGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGTKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLYTAEYSDSSYFSSDESD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: TO, Tdo, TDO, TRPO, Tryptophanase, Tryptophan pyrrolase, Tryptophan oxygenase, Tryptamin 2,3-dioxygenase, Tryptophan 2,3-dioxygenase
Supplier: United States Biological
Supplier-Nr: 375519

Properties

Conjugate: No
MW: 49,8
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "TDO2, Recombinant, Mouse, aa1-406, His-Tag (Tryptophan 2,3-Dioxygenase)"
Write a review
or to review a product.
Viewed