Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag

Required for the transport of riboflavin to the developing oocyte. Source: Recombinant protein corresponding to aa18-225 from chicken, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.8kD, AA Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.