Pre-Pro-Atrial Natriuretic Peptide, Recombinant, Human, aa1-126 (Natriuretic Peptides A, CDD-ANF, Pr

Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Source: Recombinant protein corresponding to aa1-126 from human Pre-Pro-Atrial Natriuretic Peptide, expressed in E. coli. Molecular Weight: ~13.81kD, AA Sequence: MNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPL, PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFG, GRMDRIGAQSGLGCNSFRY, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.