Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)

Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374728.20 20 µg - -

3 - 19 business days*

575.00€
374728.100 100 µg - -

3 - 19 business days*

855.00€
 
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.... more
Product information "Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)"
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. Source: Recombinant protein corresponding to aa21-137 from mouse Pla2g5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.8kD, AA Sequence: GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Pla2g5, PLA2-10, Phospholipase A2 group V, Phosphatidylcholine 2-acylhydrolase 5
Supplier: United States Biological
Supplier-Nr: 374728

Properties

Conjugate: No
Host: E.coli
Species reactivity: mouse
MW: 29.8 kD
Purity: ?90% (SDS-PAGE)

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Pla2g5, Recombinant, Mouse, aa21-137, His-SUMO-Tag (Calcium-dependent Phospholipase A2)"
Write a review
or to review a product.
Viewed