Peptidyl-Prolyl Cis-Trans Isomerase A, Recombinant, E. coli O6:H1, aa25-190, His-Sumo-Tag, Myc-Tag (

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Source: Recombinant protein corresponding to aa25-190 of E. coli O6:H1 Peptidyl-Prolyl Cis-Trans Isomerase A, fused to 10xHis-Sumo-Tag and N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~38.1kD, AA Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.