Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)

Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374168.20 20 µg - -

3 - 19 business days*

621.00€
374168.100 100 µg - -

3 - 19 business days*

947.00€
 
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and... more
Product information "Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)"
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-, -Ile-5' bond of angiotensin I and the 'Phe-20-, -Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-, -His-9' bond of angiotensin I and the 'Phe-4-, -Ala-5' and 'Tyr-10-, -Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing. Source: Recombinant protein corresponding to aa21-246 from mouse Mcpt4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.1kD, AA Sequence: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Mcpt4, MSMCP, mMCP-4, Myonase, EC=3.4.21.-, Mast cell protease 4, Serosal mast cell protease
Supplier: United States Biological
Supplier-Nr: 374168

Properties

Conjugate: No
MW: 27,1
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)"
Write a review
or to review a product.
Viewed