Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
![Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
374167.20 | 20 µg | - | - |
3 - 19 business days* |
575.00€
|
||
374167.100 | 100 µg | - | - |
3 - 19 business days* |
855.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and... more
Product information "Mcpt4, Recombinant, Mouse, aa21-246, His-Tag (Mast Cell Protease 4)"
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-, -Ile-5' bond of angiotensin I and the 'Phe-20-, -Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-, -His-9' bond of angiotensin I and the 'Phe-4-, -Ala-5' and 'Tyr-10-, -Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing. Source: Recombinant protein corresponding to aa21-246 from mouse Mcpt4, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~29.1kD, AA Sequence: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: | Mcpt4, MSMCP, mMCP-4, Myonase, EC=3.4.21.-, Mast cell protease 4, Serosal mast cell protease |
Supplier: | United States Biological |
Supplier-Nr: | 374167 |
Properties
Conjugate: | No |
MW: | 29,1 |
Format: | Purified |
Database Information
KEGG ID : | K01329 | Matching products |
UniProt ID : | P21812 | Matching products |
Gene ID | GeneID 17227 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed