Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)

Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374067.20 20 µg - -

3 - 19 business days*

575.00€
374067.100 100 µg - -

3 - 19 business days*

855.00€
 
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in... more
Product information "Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)"
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Source: Recombinant protein corresponding to aa163-411 from rat Lox, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD, AA Sequence: DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Lox, Lysyl oxidase, Protein-lysine 6-oxidase
Supplier: United States Biological
Supplier-Nr: 374067

Properties

Conjugate: No
MW: 33
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Lox, Recombinant, Rat, aa163-411, His-Tag (Protein-lysine 6-oxidase)"
Write a review
or to review a product.
Viewed