JAK3, Recombinant, Mouse, aa818-110, His-Tag (Tyrosine-Protein Kinase Jak3)

JAK3, Recombinant, Mouse, aa818-110, His-Tag (Tyrosine-Protein Kinase Jak3)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373887.20 20 µg - -

3 - 19 business days*

497.00€
373887.100 100 µg - -

3 - 19 business days*

777.00€
 
Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or... more
Product information "JAK3, Recombinant, Mouse, aa818-110, His-Tag (Tyrosine-Protein Kinase Jak3)"
Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the Cytoplasmic domain tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their Cytoplasmic domain. Then, STAT5A AND STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion. Source: Recombinant protein corresponding to aa818-110 from mouse Jak3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~34.2kD, AA Sequence: LKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Jak3, JAK-3, EC=2.7.10.2, Janus kinase 3, Tyrosine-protein kinase JAK3
Supplier: United States Biological
Supplier-Nr: 373887

Properties

Conjugate: No
MW: 34,2
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "JAK3, Recombinant, Mouse, aa818-110, His-Tag (Tyrosine-Protein Kinase Jak3)"
Write a review
or to review a product.
Viewed