Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
![ICOS, Fc Fusion, Recombinant, Human, aa21-140 (Inducible T-Cell Costimulator and CD Antigen 278, Act](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
298414.100 | 100 µg | - | - |
3 - 19 business days* |
939.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It... more
Product information "ICOS, Fc Fusion, Recombinant, Human, aa21-140 (Inducible T-Cell Costimulator and CD Antigen 278, Act"
The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq, Jul 2008]. Source: Recombinant Fc fusion protein corresponding to aa21-140 from human ICOS at C-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~40.2kD, runs at a higher MW by SDS-PAGE due to glycosylation, AA Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKS, LKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQ, LKIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS, HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS, NKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES, NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS, LSLSPGK, Applications: Suitable for use in the study of protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: | ICOS, AILIM, CD278, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule |
Supplier: | United States Biological |
Supplier-Nr: | 298414 |
Properties
Conjugate: | No |
MW: | 40,2 |
Format: | Highly Purified |
Database Information
KEGG ID : | K06713 | Matching products |
UniProt ID : | Q9Y6W8 | Matching products |
Gene ID | GeneID 29851 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | -80°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed