Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe

Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe
Item number Size Datasheet Manual SDS Delivery time Quantity Price
H1821-25C.10 10 µg - -

3 - 19 business days*

790.00€
 
Post-translational modifications of conserved N-terminal tail residues in histones regulate many... more
Product information "Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe"
Post-translational modifications of conserved N-terminal tail residues in histones regulate many aspects of chromosome activity. Mitotic phosphorylation of H3 Thr 3 occurs in prophase and dephosphorylation during anaphase. Haspin, a dual serine/threonine kinase, plays an important role in regulation of chromosome and spindle function during mitosis and meiosis via its function in phosphorylation of the threonine residue in the third position of histone 3 (Thr3). Source: Human GSG2 partial ORF (NP_114171, aa699-798, recombinant protein with GST-tag at N-terminal. Sequence: VFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK , Theoretical MW (kD): 36.63, Preparation Method: In vitro wheat germ expression system, Quality Control: 12.5% SDS-PAGE Stained with Coomassie Blue, Storage and Stability: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Keywords: GSG2, H-haspin, EC=2.7.11.1, Germ cell-specific gene 2 protein, Serine/threonine-protein kinase haspin, Haploid germ cell-specific nuclear protein kinase
Supplier: United States Biological
Supplier-Nr: H1821-25C

Properties

Conjugate: No
Species reactivity: human
Format: Affinity Purified

Handling & Safety

Storage: -80°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe"
Write a review
or to review a product.
Viewed