Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
H1821-25C.10 | 10 µg | - | - |
3 - 19 business days* |
773.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Post-translational modifications of conserved N-terminal tail residues in histones regulate many... more
Product information "Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe"
Post-translational modifications of conserved N-terminal tail residues in histones regulate many aspects of chromosome activity. Mitotic phosphorylation of H3 Thr 3 occurs in prophase and dephosphorylation during anaphase. Haspin, a dual serine/threonine kinase, plays an important role in regulation of chromosome and spindle function during mitosis and meiosis via its function in phosphorylation of the threonine residue in the third position of histone 3 (Thr3). Source: Human GSG2 partial ORF (NP_114171, aa699-798, recombinant protein with GST-tag at N-terminal. Sequence: VFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK , Theoretical MW (kD): 36.63, Preparation Method: In vitro wheat germ expression system, Quality Control: 12.5% SDS-PAGE Stained with Coomassie Blue, Storage and Stability: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Keywords: | GSG2, H-haspin, EC=2.7.11.1, Germ cell-specific gene 2 protein, Serine/threonine-protein kinase haspin, Haploid germ cell-specific nuclear protein kinase |
Supplier: | United States Biological |
Supplier-Nr: | H1821-25C |
Properties
Conjugate: | No |
Species reactivity: | human |
Format: | Affinity Purified |
Database Information
KEGG ID : | K16315 | Matching products |
UniProt ID : | Q8TF76 | Matching products |
Gene ID : | GeneID 83903 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed