GUCY1B1 PrEST Antigen

GUCY1B1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95569.100 100 µl

7 - 10 business days*

265.00€
 
PrEST Antigen GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative... more
Product information "GUCY1B1 PrEST Antigen"
PrEST Antigen GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Antigen sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium] Mouse gene identity: 98% Rat gene identity: 98%
Keywords: GUC1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95569

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "GUCY1B1 PrEST Antigen"
Write a review
or to review a product.
Viewed