Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)

Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370631.20 20 µg - -

3 - 19 business days*

511.00€
370631.100 100 µg - -

3 - 19 business days*

773.00€
 
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and... more
Product information "Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)"
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides. Source: Recombinant protein corresponding to aa29-361 from human QPCT, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.9kD, AA Sequence: VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL, , Storag
Keywords: QC, EC, sQC, QPCT, EC=2.3.2.5, Glutamyl cyclase, Glutaminyl cyclase, Glutaminyl-tRNA cyclotransferase, Glutaminyl-peptide cyclotransferase
Supplier: United States Biological
Supplier-Nr: 370631

Properties

Conjugate: No
MW: 53,9
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)"
Write a review
or to review a product.
Viewed