Gcgr, Recombinant, Mouse, aa27-143, His-Tag (Glucagon Receptor)

Gcgr, Recombinant, Mouse, aa27-143, His-Tag (Glucagon Receptor)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373408.20 20 µg - -

3 - 19 business days*

497.00€
373408.100 100 µg - -

3 - 19 business days*

777.00€
 
G-protein coupled receptor for glucagon that plays a central role in the regulation of blood... more
Product information "Gcgr, Recombinant, Mouse, aa27-143, His-Tag (Glucagon Receptor)"
G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system. Source: Recombinant protein corresponding to aa27-143 from mouse Glucagon Receptor, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.8kD, AA Sequence: AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: GL-R, Gcgr, Glucagon receptor
Supplier: United States Biological
Supplier-Nr: 373408

Properties

Conjugate: No
MW: 15,8
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Gcgr, Recombinant, Mouse, aa27-143, His-Tag (Glucagon Receptor)"
Write a review
or to review a product.
Viewed