DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)

DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373083.20 20 µg - -

3 - 19 business days*

575.00€
373083.100 100 µg - -

3 - 19 business days*

855.00€
 
Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal... more
Product information "DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)"
Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units. Source: Recombinant protein corresponding to aa21-305 from human DNASE1L3,  fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~60.4kD, AA Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: LSD, DHP2, LS-DNase, DNase gamma, EC=3.1.21.-, DNase I-like 3, Liver and spleen DNase, Deoxyribonuclease gamma, Deoxyribonuclease I-like 3, DNase I homolog protein DHP2
Supplier: United States Biological
Supplier-Nr: 373083

Properties

Conjugate: No
MW: 60,4
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "DNASE1L3, Recombinant, Human, aa21-305, GST-Tag (Deoxyribonuclease gamma)"
Write a review
or to review a product.
Viewed