Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)

Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372969.20 20 µg - -

3 - 19 business days*

621.00€
372969.100 100 µg - -

3 - 19 business days*

947.00€
 
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group... more
Product information "Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)"
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (By similarity). Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons. Source: Recombinant protein corresponding to aa2-561 from mouse Cystathionine beta-Synthase, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~63.4kD, AA Sequence: PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: CBS, Beta-thionase, Serine sulfhydrase, Cystathionine beta-synthase
Supplier: United States Biological
Supplier-Nr: 372969

Properties

Conjugate: No
MW: 63,4
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)"
Write a review
or to review a product.
Viewed