Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)

Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372968.20 20 µg - -

3 - 19 business days*

575.00€
372968.100 100 µg - -

3 - 19 business days*

855.00€
 
Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of... more
Product information "Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)"
Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury. Source: Recombinant protein corresponding to aa2-561 from mouse Cbs, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~65.4kD, AA Sequence: PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: CBS, Beta-thionase, Serine sulfhydrase, Cystathionine beta-synthase
Supplier: United States Biological
Supplier-Nr: 372968

Properties

Conjugate: No
MW: 65,4
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)"
Write a review
or to review a product.
Viewed