Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
![CRHR1, Recombinant, Human, aa23-121, His-Tag (Corticotropin-releasing Factor Receptor 1)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
372865.20 | 20 µg | - | - |
3 - 19 business days* |
531.00€
|
||
372865.100 | 100 µg | - | - |
3 - 19 business days* |
773.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high... more
Product information "CRHR1, Recombinant, Human, aa23-121, His-Tag (Corticotropin-releasing Factor Receptor 1)"
G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli. Source: Recombinant protein corresponding to aa23-121 from human CRHR1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.1kD, AA Sequence: ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: | CRFR, CRHR1, CRF-R1, CRH-R1, CRFR-1, CRF-R-1, CRH-R-1, Corticotropin-releasing factor receptor 1, Corticotropin-releasing hormone receptor 1 |
Supplier: | United States Biological |
Supplier-Nr: | 372865 |
Properties
Conjugate: | No |
MW: | 13,1 |
Format: | Highly Purified |
Database Information
KEGG ID : | K04578 | Matching products |
UniProt ID : | P34998 | Matching products |
Gene ID | GeneID 104909134 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed