CMA1, Recombinant, Macaca Fascicularis, aa22-247, His-SUMO-Tag (Chymase)

CMA1, Recombinant, Macaca Fascicularis, aa22-247, His-SUMO-Tag (Chymase)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372800.20 20 µg - -

3 - 19 business days*

636.00€
372800.100 100 µg - -

3 - 19 business days*

985.00€
 
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation,... more
Product information "CMA1, Recombinant, Macaca Fascicularis, aa22-247, His-SUMO-Tag (Chymase)"
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular domain matrix degradation, and regulation of gland secretion. Source: Recombinant protein corresponding to aa22-247 from macaca fascucularis CMA1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~41.1kD, AA Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: CMA1, Chymase, EC=3.4.21.39, Alpha-chymase
Supplier: United States Biological
Supplier-Nr: 372800

Properties

Conjugate: No
MW: 41,1
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CMA1, Recombinant, Macaca Fascicularis, aa22-247, His-SUMO-Tag (Chymase)"
Write a review
or to review a product.
Viewed