CEACAM4, Recombinant, Human, aa36-155, His-Tag (Carcinoembryonic Antigen-related Cell Adhesion Molec

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. Source: Recombinant protein corresponding to aa36-155 from human CEACAM4, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.7kD, AA Sequence: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.