CALML5, Recombinant, Human, aa2-146, His-SUMO-Tag (Calmodulin-like Protein 5)

Binds calcium. May be involved in terminal differentiation of keratinocytes. Source: Recombinant protein corresponding to aa2-146 from human CALML5, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~31.8kD, AA Sequence: AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.