CACNA1I PrEST Antigen

CACNA1I PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95994.100 100 µl

7 - 10 business days*

265.00€
 
PrEST Antigen CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I,... more
Product information "CACNA1I PrEST Antigen"
PrEST Antigen CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I, Alternative Gene Names: Cav3.3, Antigen sequence: HHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This channel gives rise to T-type calcium currents. T-type calcium channels belong to the 'low-voltage activated (LVA)' group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes. Gates in voltage ranges similar to, but higher than alpha 1G or alpha 1H. [The UniProt Consortium] Mouse gene identity: 78% Rat gene identity: 78%
Keywords: CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel subunit alpha-1I
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95994

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CACNA1I PrEST Antigen"
Write a review
or to review a product.
Viewed