Beta-2-Microglobulin, Recombinant, Sheep, aa21-118, His-Tag, Myc-Tag (B2M)

Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Source: Recombinant protein corresponding to aa21-118 of sheep Beta-2-Microglobulin, fused to 10xHis-Tag and C-terminal Myc-Tag, expressed in E. coli. Molecular Weight: ~18.6kD, AA Sequence: IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.