Annexin A4, Recombinant, Human, aa2-319, His-Sumo-Tag, Myc-Tag (ANXA4)

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. Source: Recombinant protein corresponding to aa2-319 of human Annexin A4, fused to 10xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~55.8kD, AA Sequence: ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.