Interleukin-8, Recombinant, Chicken, aa17-102, His-Tag (IL8)

Interleukin-8, Recombinant, Chicken, aa17-102, His-Tag (IL8)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370667.20 20 µg - -

3 - 19 business days*

636.00€
370667.100 100 µg - -

3 - 19 business days*

985.00€
 
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the... more
Product information "Interleukin-8, Recombinant, Chicken, aa17-102, His-Tag (IL8)"
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chotactic for peripheral blood mononuclear cells as well as for heterophils. Source: Recombinant protein corresponding to aa17-102 from chicken IL8, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.5kD, AA Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: 9E3, CEF4, IL-8, CEF-4, EMF-1, CXCL8, Interleukin-8, C-X-C motif chemokine 8, Embryo fibroblast protein 1, Chemokine (C-X-C motif) ligand 8
Supplier: United States Biological
Supplier-Nr: 370667

Properties

Conjugate: No
MW: 13,5
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Interleukin-8, Recombinant, Chicken, aa17-102, His-Tag (IL8)"
Write a review
or to review a product.
Viewed